Sequence 1: | NP_649379.1 | Gene: | CG7133 / 40449 | FlyBaseID: | FBgn0037150 | Length: | 353 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491030.1 | Gene: | dnj-30 / 171833 | WormBaseID: | WBGene00001048 | Length: | 238 | Species: | Caenorhabditis elegans |
Alignment Length: | 107 | Identity: | 28/107 - (26%) |
---|---|---|---|
Similarity: | 48/107 - (44%) | Gaps: | 8/107 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNED----GAKEFLRINEAHRVLIDH-QRRALYDCC 68
Fly 69 FQSMDVEAIIPAENANGQLPELGNPFFPMPPETPPASFREKL 110 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7133 | NP_649379.1 | DnaJ | 7..66 | CDD:278647 | 17/61 (28%) |
DnaJ | 7..>66 | CDD:223560 | 17/61 (28%) | ||
dnj-30 | NP_491030.1 | DnaJ | 41..97 | CDD:197617 | 16/53 (30%) |
DUF1451 | <167..>206 | CDD:388613 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |