DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and AgaP_AGAP012194

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_320338.4 Gene:AgaP_AGAP012194 / 1280492 VectorBaseID:AGAP012194 Length:259 Species:Anopheles gambiae


Alignment Length:307 Identity:69/307 - (22%)
Similarity:118/307 - (38%) Gaps:104/307 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKE----FLRINEAHRVLIDHQRRALYDC 67
            |:|::|.:.|.||::|||.|:::|:|::|||||.|..:|    |..|:||:.||.|.::|.:|| 
Mosquito     3 DYYKILDVSRTATEAEIKKAYKKLALRWHPDKNMDNPEESNRRFKEISEAYEVLSDEKKRRIYD- 66

  Fly    68 CFQSMDVEAII-------------PAENANGQLPELGNPFFPMPPETPPASFREKLKVAAFIGGL 119
               ....:.::             ...|.:..:.:.....||.....|...|||      |.|| 
Mosquito    67 ---QYGKDGLMNNGSDRYHQSTRHRRHNGSSGMDDFEFFGFPFTFRDPEDVFRE------FFGG- 121

  Fly   120 LVGTYVGYRVFQKPPPSIPVPRPIPTQELSDSHLGSLWTLSSGLLALRSKRILGLGKLA------ 178
                                   .|..||..|           :.:|....:|..|:.|      
Mosquito   122 -----------------------SPFDELFRS-----------MFSLTHIHVLRHGRRANGATNG 152

  Fly   179 -----------------PWANTRVSPRTLNAPFSSAAK----VVAKTVIRGQRAVGSSATSSSSL 222
                             |:....:|...::..||.|.:    .|::..|.|...|..::||::.:
Mosquito   153 HHHHHQRHSHPQNVISSPFMTPLMSFSLMDDFFSGAPRGGMSSVSEYTIGGGGPVKRTSTSTTFI 217

  Fly   223 ASAANVAVKSLPSKASVNSATETV---------AKTLSQGSRAGPYS 260
            ..      |.|.:|....:.|||:         :||::..::|.||:
Mosquito   218 NG------KKLMTKKVYENGTETIMSYENDVLKSKTVNGVAQAIPYN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 27/62 (44%)
DnaJ 7..>66 CDD:223560 27/62 (44%)
AgaP_AGAP012194XP_320338.4 DnaJ 2..>124 CDD:223560 39/154 (25%)
DnaJ 3..66 CDD:278647 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.