DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and AgaP_AGAP008985

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_319734.4 Gene:AgaP_AGAP008985 / 1279947 VectorBaseID:AGAP008985 Length:474 Species:Anopheles gambiae


Alignment Length:101 Identity:29/101 - (28%)
Similarity:53/101 - (52%) Gaps:16/101 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKE--------FLRINEAHRVLIDHQRR 62
            :|:|::||:.:.|::.|||.|:|:.:|.:|||::.:...|        |..:.||:.:|.|..::
Mosquito   356 KDYYKILGVTKQASEDEIKKAYRKRALVHHPDRHANATDEEKKEQERKFKELGEAYTILSDPVKK 420

  Fly    63 ALYDC--CFQSMDVEAIIPAENANGQLPELGNPFFP 96
            :.||.  ..:.|:..|.|..:....|.      |||
Mosquito   421 SRYDSGQDLEEMNHSADIDPQQIYRQF------FFP 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 20/66 (30%)
DnaJ 7..>66 CDD:223560 20/66 (30%)
AgaP_AGAP008985XP_319734.4 TPR_11 4..69 CDD:290150
TPR repeat 4..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR_11 38..103 CDD:290150
TPR repeat 106..131 CDD:276809
TPR repeat 156..180 CDD:276809
TPR_11 185..263 CDD:290150
TPR repeat 185..215 CDD:276809
TPR repeat 265..299 CDD:276809
TPR_11 269..334 CDD:290150
TPR_1 270..303 CDD:278916
TPR repeat 304..332 CDD:276809
TPR 305..336 CDD:197478
DnaJ 357..424 CDD:278647 20/66 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.