DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7133 and AgaP_AGAP008327

DIOPT Version :9

Sequence 1:	NP_649379.1	Gene:	CG7133 / 40449	FlyBaseID:	FBgn0037150	Length:	353	Species:	Drosophila melanogaster
Sequence 2:	XP_317136.4	Gene:	AgaP_AGAP008327 / 1277658	VectorBaseID:	AGAP008327	Length:	359	Species:	Anopheles gambiae

Alignment Length:	65	Identity:	26/65 - (40%)
Similarity:	44/65 - (67%)	Gaps:	3/65 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNE---DGAKEFLRINEAHRVLIDHQRRALYDCC 68
            |.|::|||.:.|:.:::|.|:|:|:.:.|||||:   |.:::|..:..|:.||.|..:|.|||.|
Mosquito    29 DFYKILGLRKTASKNDVKKAYRKLAKELHPDKNKDDPDASQKFQDLGAAYEVLSDDDKRKLYDRC 93

Fly 69 68
Mosquito 94 93

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7133	NP_649379.1	DnaJ	7..66	CDD:278647	23/61 (38%)
CG7133	NP_649379.1	DnaJ	7..>66	CDD:223560	23/61 (38%)
AgaP_AGAP008327	XP_317136.4	DnaJ	26..345	CDD:223560	26/65 (40%)
		DnaJ	29..91	CDD:278647	23/61 (38%)
		DnaJ_C	133..330	CDD:199909
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910