DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and AgaP_AGAP000831

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_316797.3 Gene:AgaP_AGAP000831 / 1277341 VectorBaseID:AGAP000831 Length:341 Species:Anopheles gambiae


Alignment Length:64 Identity:24/64 - (37%)
Similarity:39/64 - (60%) Gaps:6/64 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPD-----KNEDGAKE-FLRINEAHRVLIDHQRRALYD 66
            |::||:.|.:|..||..::|:|:.:||||     :.:..|:| |.||..|:.||.|.:.|..|:
Mosquito    38 YELLGVSRESTKQEIAKSYRQLARKYHPDLHHGPEQKQAAEESFKRIATAYEVLKDEESRNDYN 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 23/62 (37%)
DnaJ 7..>66 CDD:223560 23/62 (37%)
AgaP_AGAP000831XP_316797.3 DnaJ 36..101 CDD:278647 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.