DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and AgaP_AGAP007620

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_308251.4 Gene:AgaP_AGAP007620 / 1269608 VectorBaseID:AGAP007620 Length:217 Species:Anopheles gambiae


Alignment Length:162 Identity:47/162 - (29%)
Similarity:67/162 - (41%) Gaps:48/162 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDK---NEDGAKEFLRINEAHRVLIDHQRRALYDCCFQ 70
            ||.|||.:.||..|||..:|:|:|:|||||   |.|.|.:|..:|.||.:|.|..:|.:|| .:.
Mosquito    14 YQTLGLQKTATADEIKKTYRKLALKYHPDKNPNNPDAADKFKEVNRAHSILSDLTKRNIYD-NYG 77

  Fly    71 SMD--VEAIIPAENANGQLPELGNPFFPMPPETPPASFREKLKVAAFIGGLLVGTYV-------- 125
            |:.  :......||.|.        :|.:...|..|.|        .|.|::.|.|.        
Mosquito    78 SLGLYIAEQFGEENVNA--------YFVVTSPTCKALF--------MICGIITGCYCCCCCCCCC 126

  Fly   126 -----GYRVFQKPPPSIPVPRPIPTQELSDSH 152
                 .|             :|:|.:...|.|
Mosquito   127 NFCFGKY-------------KPVPPENAGDYH 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 28/59 (47%)
DnaJ 7..>66 CDD:223560 28/59 (47%)
AgaP_AGAP007620XP_308251.4 DnaJ 12..74 CDD:278647 28/59 (47%)
DnaJ 14..>81 CDD:223560 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.