DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and dnajb5

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_012821923.1 Gene:dnajb5 / 100487123 XenbaseID:XB-GENE-995211 Length:407 Species:Xenopus tropicalis


Alignment Length:118 Identity:43/118 - (36%)
Similarity:64/118 - (54%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVYEDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKE--FLRINEAHRVLIDHQRRALY 65
            |:.:|:|::|||...|.:.|||.|:|:::|:||||||:|...|  |..|.||:.||.|.::||:|
 Frog    59 DMGKDYYKILGLASGANEDEIKKAYRKMALKYHPDKNKDANAEDKFKEIAEAYDVLSDPKKRAVY 123

  Fly    66 DCCFQSMDVEAIIPAENANGQLPELGNPFFPMPPETPPASFREKLKVAAFIGG 118
            |    ....|.:   :...|.....|:.|.......|.|:|      |:|.||
 Frog   124 D----QYGEEGL---KTGGGSTGNTGSSFHYTFHGDPHATF------ASFFGG 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 29/60 (48%)
DnaJ 7..>66 CDD:223560 29/60 (48%)
dnajb5XP_012821923.1 DnaJ 60..402 CDD:223560 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.