DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7139 and N4BP2L1

DIOPT Version :9

Sequence 1:NP_649378.1 Gene:CG7139 / 40448 FlyBaseID:FBgn0027532 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_001340556.1 Gene:N4BP2L1 / 90634 HGNCID:25037 Length:335 Species:Homo sapiens


Alignment Length:223 Identity:78/223 - (34%)
Similarity:105/223 - (47%) Gaps:34/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SGGTHRKYATAEAPSSIRMCPASNLNSNQSNKQFNSICQRAQAGHKLMIIMRGPSGSGKSTLAES 122
            |.|.|| |||.      .:.|       |....:...|.|     .|.||    |...|......
Human   106 SKGFHR-YATG------GIYP-------QEMSTYTQECSR-----YLGII----SEQNKDPALVD 147

  Fly   123 LLRQAHLLDRHQV-RDFVLSSDDYFKTRRG-YVFNPTLLPAAHEWNQQRVRDKAASGWSPIIVDN 185
            |:.|..|  :|.. |..:.|:||:|....| |.|||..|..||||||:|.|....:|.||||:||
Human   148 LMCQRQL--QHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDN 210

  Fly   186 TNTMVWEMQPYVQFAVRHGYVIELLEPNTSWCKSASKLAQKNVHNVPRENIQRMLERFER-TTAG 249
            ||...|||:||...|:.:.|.:...||:|.|..:..:||::|:|.|.||.|.||.||:|. .|..
Human   211 TNLHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDVTFH 275

  Fly   250 ELIQLMKETKYSVELPQLRNHPPLPAVP 277
            .::...|.::.:      ||.....|:|
Human   276 SVLHAEKPSRMN------RNQDRNNALP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7139NP_649378.1 NK 105..277 CDD:302627 65/174 (37%)
AAA_33 105..245 CDD:290396 59/141 (42%)
GluZincin 606..>707 CDD:301352
DUF1771 812..868 CDD:285756
SMR 877..960 CDD:214676
N4BP2L1NP_001340556.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
P-loop_NTPase 46..>103 CDD:328724
AAA_33 165..269 CDD:330919 50/103 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5690
eggNOG 1 0.900 - - E1_KOG2401
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D48413at33208
OrthoFinder 1 1.000 - - FOG0001378
OrthoInspector 1 1.000 - - otm40831
orthoMCL 1 0.900 - - OOG6_106095
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1948
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.