DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7139 and YPL199C

DIOPT Version :9

Sequence 1:NP_649378.1 Gene:CG7139 / 40448 FlyBaseID:FBgn0027532 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_015125.1 Gene:YPL199C / 855902 SGDID:S000006120 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:43/169 - (25%)
Similarity:77/169 - (45%) Gaps:33/169 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   805 LRDF-----EETRNMAAHHSQLKAECYLKAKQ-------AVQRGNSSVALYYSEIAKLHKQKIDV 857
            :||:     ||.:.:    .:|..|.|.|..|       |.|:|:..:|...||.:|...:..:.
Yeast    15 VRDYNHSTDEEYQRL----RRLADEAYKKRDQLSHESQTAYQQGDKKLAHELSEKSKAQLKTAED 75

  Fly   858 FNQRAANCIMEVHRHTQNNPDLLDLHYLHTVEAISCLD----LFLDRHITVLRNTTRVYKHVFII 918
            ||.:||..:. |..:..::.:.:|||.|:..||:..|.    ..:|.:...|.          :|
Yeast    76 FNMQAAEYVF-VENNADSSSNEIDLHGLYVKEALFILQKRIKFAIDHNEPQLN----------VI 129

  Fly   919 TGRGLHSANGVSTIKNRVKARLGERRLR--WQEVNPGLL 955
            .|:||||.||::.:|..::....:..:|  .::.|.|:|
Yeast   130 VGKGLHSQNGIAKLKPSIEEFCAKHGIRNHLEKGNSGVL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7139NP_649378.1 NK 105..277 CDD:302627
AAA_33 105..245 CDD:290396
GluZincin 606..>707 CDD:301352
DUF1771 812..868 CDD:285756 16/62 (26%)
SMR 877..960 CDD:214676 22/85 (26%)
YPL199CNP_015125.1 DUF1771 28..89 CDD:400763 17/65 (26%)
SMR 94..172 CDD:214676 22/85 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2401
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3681
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001378
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1948
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.