DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7139 and CUE2

DIOPT Version :9

Sequence 1:NP_649378.1 Gene:CG7139 / 40448 FlyBaseID:FBgn0027532 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_012833.1 Gene:CUE2 / 853772 SGDID:S000001573 Length:443 Species:Saccharomyces cerevisiae


Alignment Length:409 Identity:75/409 - (18%)
Similarity:140/409 - (34%) Gaps:137/409 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   649 DCSESPSNVAELLDM--ELAWSIYNSEQLAAKKAAELTARKQTPTDIATHLTKMKLCET------ 705
            |.|...:.:.:|.||  :|..|:...:.:..:|:.|     .|.:|:..:.|..||.:.      
Yeast    52 DKSTVDNELHQLYDMFPQLDCSVIKDQFVINEKSVE-----STISDLLNYETLQKLKDNQANSPD 111

  Fly   706 -----------------------FPDVPTDTVLEVFAATGSNYVQTVEVLDSNVKSMLSKAELYD 747
                                   |.|.|.:...|..|..|.:.|:.:      :|.:|   :.||
Yeast   112 SVKRNEKKNNWESTNDHIESIIKFTDAPKNIAQEYLAENGFDTVKAI------IKIIL---DYYD 167

  Fly   748 KALREGEKLSEQMALEERRQQQQQKQHNSSGQGQRSSSS-------------------------S 787
            |  |:.:|..:...:        ::..|::.:|.|..||                         |
Yeast   168 K--RDFKKDVDTFKV--------KRSPNTTVRGGRVQSSTGLAHVLKKGKESANVAQESLKRPRS 222

  Fly   788 YA-SGRSPQLQEEVKCAALRDFEETRNMAAHHSQLKAEC----------YLKAKQAVQRGNSSV- 840
            |. |..|||:.|..:..|     :.|::.|.:.:...:|          .|.....:...:.:: 
Yeast   223 YKHSLDSPQMVELNELVA-----DNRDLKAINHEFLQKCLQFYDGDVVKVLNISSLLIEDDKNIT 282

  Fly   841 ---------ALYYSEIAKLHKQKIDVFNQRAANCIMEVHR---HTQNNPD-------------LL 880
                     .|...:..|.|..|.........|.:...::   |.:..|:             .|
Yeast   283 KTWNFDEGFTLTSRDNCKQHLPKFSTPQISRRNEVGNTYKLPLHDKETPEGAVPVINNLFQTYRL 347

  Fly   881 DLHYLHTVEAISCLDLFLDR--------------HITVLRNTTRVYKHVFIITGRGLHSANGVST 931
            |.|.....||:|.|.|.|::              :|....:..:....:.::||||:||..|:|.
Yeast   348 DFHGFLPSEAVSTLKLALNKWWSKEVAERELNSHNINSYGSKVQFVSPLIVVTGRGIHSIGGISK 412

  Fly   932 IKNRVKARLGERR-LRWQE 949
            ::.:||:.|.:.. :.|:|
Yeast   413 VRLQVKSFLEKNHYIFWEE 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7139NP_649378.1 NK 105..277 CDD:302627
AAA_33 105..245 CDD:290396
GluZincin 606..>707 CDD:301352 14/88 (16%)
DUF1771 812..868 CDD:285756 9/75 (12%)
SMR 877..960 CDD:214676 24/101 (24%)
CUE2NP_012833.1 CUE1_Cue2p_like 10..51 CDD:270557
CUE2_Cue2p_like 57..94 CDD:270558 9/41 (22%)
SMR 344..440 CDD:214676 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2401
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46535
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.