DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7139 and n4bp2l2

DIOPT Version :9

Sequence 1:NP_649378.1 Gene:CG7139 / 40448 FlyBaseID:FBgn0027532 Length:969 Species:Drosophila melanogaster
Sequence 2:XP_693749.2 Gene:n4bp2l2 / 565380 ZFINID:ZDB-GENE-131121-433 Length:450 Species:Danio rerio


Alignment Length:142 Identity:63/142 - (44%)
Similarity:88/142 - (61%) Gaps:7/142 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LMIIMRGPSGSGKSTLAESLLRQAHLLDRHQVRDFVLSSDDYFKTRRGYVFNPTLLPAAHEWNQQ 168
            :::::||..||||||||..||...       ....|||:||||.....|.|:..||..||:|||:
Zfish   296 VLVLLRGVPGSGKSTLARELLSTG-------PNGVVLSTDDYFFQDNRYAFDSALLGDAHDWNQK 353

  Fly   169 RVRDKAASGWSPIIVDNTNTMVWEMQPYVQFAVRHGYVIELLEPNTSWCKSASKLAQKNVHNVPR 233
            |.......|.||:|:||||...|||:|||:.|:.:||.::.|||:|.|....::|.::|.|.|||
Zfish   354 RAEQAMLDGCSPVIIDNTNVKAWEMKPYVELALENGYRVDFLEPDTPWKCDPAQLEKRNKHGVPR 418

  Fly   234 ENIQRMLERFER 245
            :.|.:||:.|||
Zfish   419 DTIAKMLDGFER 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7139NP_649378.1 NK 105..277 CDD:302627 63/141 (45%)
AAA_33 105..245 CDD:290396 61/139 (44%)
GluZincin 606..>707 CDD:301352
DUF1771 812..868 CDD:285756
SMR 877..960 CDD:214676
n4bp2l2XP_693749.2 NK 294..431 CDD:302627 63/142 (44%)
AAA_33 297..431 CDD:290396 63/141 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5124
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D48413at33208
OrthoFinder 1 1.000 - - FOG0001378
OrthoInspector 1 1.000 - - otm25054
orthoMCL 1 0.900 - - OOG6_106095
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.