DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7139 and N4bp2l1

DIOPT Version :9

Sequence 1:NP_649378.1 Gene:CG7139 / 40448 FlyBaseID:FBgn0027532 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_001030299.1 Gene:N4bp2l1 / 498131 RGDID:1595713 Length:238 Species:Rattus norvegicus


Alignment Length:149 Identity:69/149 - (46%)
Similarity:91/149 - (61%) Gaps:8/149 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RAQAGHKLMIIMRGPSGSGKSTLAESLLRQAHLLDRHQVRDFVLSSDDYFKTRRG-YVFNPTLLP 160
            |..:..|.:.::||..||||:|||    ||   |.|...|..:.|:||:|....| |.|||..|.
  Rat    34 RRHSFRKHLYLLRGLPGSGKTTLA----RQ---LQRDYPRALIFSTDDFFFREDGTYEFNPIFLE 91

  Fly   161 AAHEWNQQRVRDKAASGWSPIIVDNTNTMVWEMQPYVQFAVRHGYVIELLEPNTSWCKSASKLAQ 225
            .||||||:|.|....||.||||:||||...|||:||...|:.:.|.:...||:|.|..:..:||:
  Rat    92 EAHEWNQKRARKAMRSGTSPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELAR 156

  Fly   226 KNVHNVPRENIQRMLERFE 244
            :|:|.||:|.||||.||:|
  Rat   157 RNIHGVPKEKIQRMKERYE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7139NP_649378.1 NK 105..277 CDD:302627 67/141 (48%)
AAA_33 105..245 CDD:290396 67/141 (48%)
GluZincin 606..>707 CDD:301352
DUF1771 812..868 CDD:285756
SMR 877..960 CDD:214676
N4bp2l1NP_001030299.1 AAA_33 42..175 CDD:404546 66/139 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5114
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D48413at33208
OrthoFinder 1 1.000 - - FOG0001378
OrthoInspector 1 1.000 - - otm44976
orthoMCL 1 0.900 - - OOG6_106095
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.