DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7139 and F02E11.4

DIOPT Version :9

Sequence 1:NP_649378.1 Gene:CG7139 / 40448 FlyBaseID:FBgn0027532 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_494494.1 Gene:F02E11.4 / 184098 WormBaseID:WBGene00017182 Length:138 Species:Caenorhabditis elegans


Alignment Length:155 Identity:38/155 - (24%)
Similarity:66/155 - (42%) Gaps:39/155 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   809 EETRNMAAHHSQLKAECYLKAKQAVQRGNSSVALYYSEIAKLHKQKIDVFNQRAANCIMEVHRHT 873
            |..|..|.||::::|...|..|.. :||         .:.||.:    ..|::    :::.:|:.
 Worm    10 EFLRMKAKHHAEIQALYELCGKMK-ERG---------ALGKLKR----TINEK----VIDWNRNG 56

  Fly   874 QNNPDLLDLHYLHTVEAISCLDLFLDRHITVLRNTTRVYKHVFIITGRGLHSANGVSTIKN---- 934
            ....|..|||.:.|..|:        |.:..:....:.|..:.:.||||.||.:.:..|||    
 Worm    57 LRVKDYYDLHGMTTNGAV--------RFVLGIVENMQFYGKIKLETGRGNHSKDNIPVIKNKLLR 113

  Fly   935 ----RVKARLGERRLRWQEVNPGLL 955
                |.:.::.|.:|     |||:|
 Worm   114 TFNCRSRCKIFEDKL-----NPGVL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7139NP_649378.1 NK 105..277 CDD:302627
AAA_33 105..245 CDD:290396
GluZincin 606..>707 CDD:301352
DUF1771 812..868 CDD:285756 12/55 (22%)
SMR 877..960 CDD:214676 24/87 (28%)
F02E11.4NP_494494.1 SMR 60..137 CDD:214676 24/87 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D48413at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.