DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7139 and Cnp

DIOPT Version :9

Sequence 1:NP_649378.1 Gene:CG7139 / 40448 FlyBaseID:FBgn0027532 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_034053.2 Gene:Cnp / 12799 MGIID:88437 Length:420 Species:Mus musculus


Alignment Length:350 Identity:78/350 - (22%)
Similarity:145/350 - (41%) Gaps:94/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KLMIIMRGPSGSGKSTLAESLLRQAHLLDRHQVRDFVLSSDDYFKTRRGYVFNPTLLPAAH-EWN 166
            |.:.|:||..||||||||..:|.:.|  |..:    ::|:|.|           .::|.:. :::
Mouse    50 KTLFILRGLPGSGKSTLARLILEKYH--DGTK----MVSADAY-----------KIIPGSRADFS 97

  Fly   167 QQRVR-DKAASGW-----SPIIVDNTNTMVWEMQPYVQFAVRHGYVIELLEPNTSWCKSASKLAQ 225
            :...| |:..:|:     ..:::|:||.....:....:.|.::.|.:.|:||.|:|....::|.:
Mouse    98 EAYKRLDEDLAGYCRRDIRVLVLDDTNHERERLDQLFEMADQYQYQVVLVEPKTAWRLDCAQLKE 162

  Fly   226 KNVHNVPRENIQRMLERFERTTAGELIQLMKE---TKYSVE---------LPQLRNH-------- 270
            ||...:..::::::....|:    :.:.|...   ||.|.|         |.:|.||        
Mouse   163 KNQWQLSADDLKKLKPGLEK----DFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELR 223

  Fly   271 ------PPLPAVPIITSFEE---------SKLLEAPVPAPAE-------------NAFKLNANAQ 307
                  .|...:.:::.|.:         :|..:....|.||             .||||:.:|.
Mouse   224 HFISGDEPKEKLELVSYFGKRPPGVLHCTTKFCDYGKAAGAEEYAQQEVVKRSYGKAFKLSISAL 288

  Fly   308 TWVPYEHGAP--------SYWSQTVNSVDTGDATVP--EIPDALGAAA---PVKSELSIIDLLRE 359
            ...|...||.        ..|...::.....:...|  .....||.||   ||::.|.::|:|: 
Mouse   289 FVTPKTAGAQVVLTDQELQLWPSDLDKPSASEGLPPGSRAHVTLGCAADVQPVQTGLDLLDILQ- 352

  Fly   360 ENQIKVVPSKAESSGAKPL-EMHSL 383
              |:| ..|:.|:.|..|. :::||
Mouse   353 --QVK-GGSQGEAVGELPRGKLYSL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7139NP_649378.1 NK 105..277 CDD:302627 45/204 (22%)
AAA_33 105..245 CDD:290396 34/146 (23%)
GluZincin 606..>707 CDD:301352
DUF1771 812..868 CDD:285756
SMR 877..960 CDD:214676
CnpNP_034053.2 NK 51..>165 CDD:302627 33/130 (25%)
CNPase 186..398 CDD:283525 41/192 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2401
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.