DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7139 and N4bp2l1

DIOPT Version :9

Sequence 1:NP_649378.1 Gene:CG7139 / 40448 FlyBaseID:FBgn0027532 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_598659.3 Gene:N4bp2l1 / 100637 MGIID:2140872 Length:238 Species:Mus musculus


Alignment Length:178 Identity:73/178 - (41%)
Similarity:98/178 - (55%) Gaps:11/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RAQAGHKLMIIMRGPSGSGKSTLAESLLRQAHLLDRHQV-RDFVLSSDDYFKTRRG-YVFNPTLL 159
            |..:..|.:.::||..||||:|||..|        :|.. |..:.|:||:|....| |.|||.||
Mouse    34 RRHSFRKHLYLLRGLPGSGKTTLARQL--------QHDYPRALIFSTDDFFFKEDGTYEFNPNLL 90

  Fly   160 PAAHEWNQQRVRDKAASGWSPIIVDNTNTMVWEMQPYVQFAVRHGYVIELLEPNTSWCKSASKLA 224
            ..||||||:|.|....:|.||||:||||...|||:||...|:.:.|.:...||:|.|..:..:||
Mouse    91 EEAHEWNQRRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELA 155

  Fly   225 QKNVHNVPRENIQRMLERFERTTAGELIQLMKETKYSVELPQLRNHPP 272
            ::|:|.||:|.||||.||:|.......: |..|........|.||..|
Mouse   156 RRNIHGVPKEKIQRMKERYEHNVTFHSV-LHAEKPSRANRNQGRNSEP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7139NP_649378.1 NK 105..277 CDD:302627 71/170 (42%)
AAA_33 105..245 CDD:290396 64/141 (45%)
GluZincin 606..>707 CDD:301352
DUF1771 812..868 CDD:285756
SMR 877..960 CDD:214676
N4bp2l1NP_598659.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 1/1 (100%)
AAA_33 42..175 CDD:290396 64/140 (46%)
NK 42..>175 CDD:302627 64/140 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..212 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5348
eggNOG 1 0.900 - - E1_KOG2401
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001378
OrthoInspector 1 1.000 - - otm42905
orthoMCL 1 0.900 - - OOG6_106095
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1948
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.