DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7139 and n4bp2l2

DIOPT Version :9

Sequence 1:NP_649378.1 Gene:CG7139 / 40448 FlyBaseID:FBgn0027532 Length:969 Species:Drosophila melanogaster
Sequence 2:XP_002934080.2 Gene:n4bp2l2 / 100493321 XenbaseID:XB-GENE-940670 Length:720 Species:Xenopus tropicalis


Alignment Length:273 Identity:88/273 - (32%)
Similarity:129/273 - (47%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NINNNNNNNKNNNNNNNN------NNNNNNNNDNN------NCGRSKSG-------GTHRKYATA 68
            ||...:|.::..:..:.|      |..|:|..:.|      .||:.:..       |....::.|
 Frog   449 NIRYGHNEHQRQDQQHWNSFPIPHNAGNSNLKEGNILFLDSECGKRQQEHRFGDALGNQESHSGA 513

  Fly    69 EAPSSIRMCPASNLNSNQSNKQFNSICQRAQAGHKLMIIMRGPSGSGKSTLAESLLRQAHLLDRH 133
            ....:....|... ::...||:.:|       ..:.::::||..||||:|||..||..       
 Frog   514 AQLHNYTYVPQER-HTEDDNKKTSS-------DERKLVLLRGLPGSGKTTLARFLLNL------- 563

  Fly   134 QVRDFVLSSDDYFKTRRGYVFNPTLLPAAHEWNQQRVRDKAASGWSPIIVDNTNTMVWEMQPYVQ 198
            ....||.|:||||..:.||.::..||..||.|||.|.|.....|.||||:||||...|||:||||
 Frog   564 NPNGFVFSTDDYFCQKDGYTYDVKLLGDAHNWNQCRARRAMDDGRSPIIIDNTNIQGWEMKPYVQ 628

  Fly   199 FAVRHGYVIELLEPNTSWCKSASKLAQKNVHNVPRENIQRMLERFERTTAGELIQLMKETKYSVE 263
            .|:..||.::.:||:..|.....:||::|.|.||:|.|.:||||:|......::.      .|||
 Frog   629 MAIERGYFVDFVEPDNWWKLDPLELAKRNTHRVPQEKISQMLERYEHNMTVPVVM------NSVE 687

  Fly   264 LPQLRNH--PPLP 274
            .|....|  ||.|
 Frog   688 PPHKNAHRRPPQP 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7139NP_649378.1 NK 105..277 CDD:302627 72/172 (42%)
AAA_33 105..245 CDD:290396 63/139 (45%)
GluZincin 606..>707 CDD:301352
DUF1771 812..868 CDD:285756
SMR 877..960 CDD:214676
n4bp2l2XP_002934080.2 AAA_33 542..674 CDD:404546 63/138 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5152
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D48413at33208
OrthoFinder 1 1.000 - - FOG0001378
OrthoInspector 1 1.000 - - otm48033
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.