DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and ACTR8

DIOPT Version :9

Sequence 1:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_075050.3 Gene:ACTR8 / 93973 HGNCID:14672 Length:624 Species:Homo sapiens


Alignment Length:465 Identity:82/465 - (17%)
Similarity:163/465 - (35%) Gaps:152/465 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HQGVMVG-----MGQKDCYVGDEAQSKRGILSLKYPIEHGIITN-WDDMEKVWHHTFYNELRVAP 99
            |...:||     :...||| ......:||.|:: :|...|.:|. ..|:|.:|.|.....|.:..
Human   162 HPEYLVGEEALYVNPLDCY-NIHWPIRRGQLNI-HPGPGGSLTAVLADIEVIWSHAIQKYLEIPL 224

  Fly   100 EE----HPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 160
            ::    ..:||.....|.:..:|.:..|:.: .....:.|..::|.:.|.||.::..::|.||..
Human   225 KDLKYYRCILLIPDIYNKQHVKELVNMILMK-MGFSGIVVHQESVCATYGSGLSSTCIVDVGDQK 288

  Fly   161 SHTVPIYEGYALPHAILRLDLA--GRDLTDYLMKILTERGYSF-----TTTAEREIVRDIKEKLC 218
            :....:.:|  :.|...||.||  |.|::.....::...|:.:     |...:..:::.:||..|
Human   289 TSVCCVEDG--VSHRNTRLCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFC 351

  Fly   219 YVALDFEQEMATAAASTSLEKSYEL--PDGQVI----TIGNERFRTPEALFQPSFLGM------- 270
            ::..|.         |...:..:::  ||...:    .:|:|:.:.|.|||.|:..|:       
Human   352 HLDQDI---------SGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTT 407

  Fly   271 ----------------------------------------------------------------- 270
                                                                             
Human   408 LQHRSQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVD 472

  Fly   271 ----------------------------------ESCGIHETVYQSIMKCDV-DIRKDLYANNVL 300
                                              ::.|:.:.:..||..|.. |.:|.:|::.::
Human   473 LGSAQGDGLMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILV 537

  Fly   301 SGGTTMYPGIADRMQKEITALAPSTIK-----IKIIAPP---ERKYSVWIGGSILASLSTFQQMW 357
            .||..|:....:.:|..|....|.:.:     :.:|..|   :.:...|.||::||.|.|.|::|
Human   538 VGGGLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELW 602

  Fly   358 ISKQEYDESG 367
            |.::|:...|
Human   603 IYQREWQRFG 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 82/465 (18%)
ACTR8NP_075050.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
NBD_sugar-kinase_HSP70_actin 162..619 CDD:388382 82/465 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..462 0/31 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.