DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and Ankrd36

DIOPT Version :9

Sequence 1:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_076305.2 Gene:Ankrd36 / 76389 MGIID:1923639 Length:1415 Species:Mus musculus


Alignment Length:341 Identity:66/341 - (19%)
Similarity:106/341 - (31%) Gaps:126/341 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NWDDMEKV--WHHTFYNELRVAPEEHPVLLTEAPL--NPKANREKM---------TQIMFETFNS 130
            |.|.::::  :.|...|...:..|:.|.|.|:.|:  :|......:         ..|.|.  ..
Mouse   289 NTDAVDELGSFAHRPSNSEPIEEEDEPSLSTKPPVVQSPVLTESNLWAGYPADWPEPIKFS--RQ 351

  Fly   131 PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPI---YEGYALPHAILRL------------- 179
            ||:|...:.                ..|..|.:||:   .:|.|||.....:             
Mouse   352 PAVYNPTEW----------------REDMESRSVPLESKQQGAALPGKEANIQTQQQLQTRAFKE 400

  Fly   180 ------DLAGRD-LTDYLMKILTE--------RGYSFTTTA--------EREIVRDIKEKLCYVA 221
                  ||..|: ..|.|:.:|..        :.:..|..|        |||.|.:.:||...:.
Mouse   401 PGANDPDLPSRENAKDELVSLLAPLEEKKPQMKEFPVTEAAKFQTDVKLEREGVLEFEEKGLEIC 465

  Fly   222 LDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRTPEALFQPSFLGMESCGIHETVYQSIMKC 286
            .|...|   ||.||   :||.:          .||..|:                      :...
Mouse   466 QDSNLE---AAEST---ESYSI----------LRFAKPD----------------------VSDP 492

  Fly   287 DVDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLS 351
            :...|||.|..:...         .||:::.:.|...|..:.|..:||..:         |...|
Mouse   493 EPTARKDEYKLDTKD---------EDRLERHLLAPKASQHQAKQTSPPPVQ---------LQERS 539

  Fly   352 TFQQMWISKQEYDESG 367
            ...:|..:..|.|.||
Mouse   540 QGPEMDTASDEEDTSG 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 66/341 (19%)
Ankrd36NP_076305.2 Ank_2 37..130 CDD:289560
ANK repeat 37..64 CDD:293786
ANK 61..186 CDD:238125
ANK repeat 68..97 CDD:293786
ANK repeat 99..130 CDD:293786
ANK repeat 132..163 CDD:293786
Ank_2 137..229 CDD:289560
ANK 162..>240 CDD:238125
ANK repeat 165..196 CDD:293786
ANK repeat 198..229 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.