DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and POTEM

DIOPT Version :9

Sequence 1:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001138914.1 Gene:POTEM / 641455 HGNCID:37096 Length:508 Species:Homo sapiens


Alignment Length:212 Identity:44/212 - (20%)
Similarity:79/212 - (37%) Gaps:53/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IEHGIITNWDDM--EKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMY 134
            :|||...|..|.  ....|:..|||.::..:  .:||..|.:..| |:..:|.::.      .::
Human   226 LEHGTDPNIPDEYGNTALHYAIYNEDKLMAK--ALLLYGADIESK-NKHGLTPLLL------GVH 281

  Fly   135 VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE---GYALPHAIL---RLDLAGRDLTDYLMKI 193
            ...|.|:......:..   |::.|....||.|..   |.|...::|   .:|::.:||:.     
Human   282 EQKQQVVKFLIKKKAN---LNALDRYGRTVLILAVCCGSASIVSLLLEQNIDVSSQDLSG----- 338

  Fly   194 LTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAAS-----------TSLEKSYELPDGQ 247
                     .||....|......:|.:..|::::.....:|           ||.|:|..|.   
Human   339 ---------QTAREYAVSSRHNVICQLLSDYKEKQILKVSSENSNPEQDLKLTSEEESQRLK--- 391

  Fly   248 VITIGNERFRTPEALFQ 264
                |:|..: ||.:.|
Human   392 ----GSENSQ-PEEMSQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 44/212 (21%)
POTEMNP_001138914.1 Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125 17/74 (23%)
ANK 1 172..201
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560 13/45 (29%)
ANK repeat 205..236 CDD:293786 4/9 (44%)
ANK 2 205..234 3/7 (43%)
ANK 233..357 CDD:238125 29/149 (19%)
ANK repeat 238..269 CDD:293786 8/33 (24%)
ANK 3 238..267 7/30 (23%)
Ank_2 243..335 CDD:289560 21/103 (20%)
ANK repeat 271..302 CDD:293786 4/39 (10%)
ANK 4 271..300 4/37 (11%)
ANK repeat 304..335 CDD:293786 7/30 (23%)
ANK 5 304..333 7/28 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 369..487 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.