DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and actl6a

DIOPT Version :9

Sequence 1:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_989337.1 Gene:actl6a / 394962 XenbaseID:XB-GENE-491948 Length:429 Species:Xenopus tropicalis


Alignment Length:429 Identity:149/429 - (34%)
Similarity:226/429 - (52%) Gaps:66/429 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYV-----GDEAQSK- 62
            :|..|||.|.||...:||:||:|.|:..||:.:|        |.:.::|...     ||:.:|: 
 Frog     9 DEVGALVFDIGSYSVRAGYAGEDCPKVDFPTTIG--------VVIDREDGSTPMETDGDQNKSRS 65

  Fly    63 -------------RGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPK 114
                         |..:....|:::|:|.:||..:.:..||:...::.....||||::||..|.:
 Frog    66 PTYYIDTNSLRVPRENMEAFSPLKNGMIEDWDSFQAIIDHTYKTHIKSETNLHPVLMSEAAWNTR 130

  Fly   115 ANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 179
            ..|||:|::|||.:|.||.::...|||:.:|:||:||::||||...:..:|:::||.|...|::.
 Frog   131 VKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGSTHTTAIPVHDGYVLQQGIVKS 195

  Fly   180 DLAGRDLTDYLMKILTERGYSFT---TTAEREIVRD-------IKEKL-------------CYVA 221
            .|||..:|....::..|......   ..|.:|.||:       .||||             | |.
 Frog   196 PLAGDFITMQCRELFQEMTVDLIPPYMIASKEAVREGATPNWKRKEKLPQVTRSWHNYMCNC-VI 259

  Fly   222 LDFEQEMATAAASTSLEK--------SYELPDGQVITIGNERFRTPEALFQPS----FLGMESCG 274
            .||:..:...:.||..|:        .||.|:|.....|.||.:.||.||.||    ..|....|
 Frog   260 QDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLG 324

  Fly   275 IHETVYQSIMKCDVDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTIKIKIIA---PPER 336
            :...|..|:..||:|||..||.:.:::||.|:..|..||:.:|::...|.::::|:||   ..||
 Frog   325 VSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLLQGFTDRLTRELSQKTPPSMRLKLIANNTTVER 389

  Fly   337 KYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKC 375
            ::|.||||||||||.||||||||||||:|.|...|.|||
 Frog   390 RFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 149/429 (35%)
actl6aNP_989337.1 Actin 11..429 CDD:306521 148/427 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.