Sequence 1: | NP_001262200.1 | Gene: | Act79B / 40444 | FlyBaseID: | FBgn0000045 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001131143.1 | Gene: | POTEC / 388468 | HGNCID: | 33894 | Length: | 542 | Species: | Homo sapiens |
Alignment Length: | 267 | Identity: | 50/267 - (18%) |
---|---|---|---|
Similarity: | 89/267 - (33%) | Gaps: | 95/267 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 GSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV-----GMGQKDCYV---------------GDE 58
Fly 59 AQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 123
Fly 124 MFETFNS-----------------------PAMYVAIQ-----AVLSLYASGRTTGIVLDSGDGV 160
Fly 161 SHTVPIYEGYALPHAILRLDLAGRD--------LTDYLMKILTERGYSFTTTAEREIVRD-IKEK 216
Fly 217 LCYVALD 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Act79B | NP_001262200.1 | PTZ00281 | 1..376 | CDD:173506 | 50/267 (19%) |
POTEC | NP_001131143.1 | ANK 1 | 138..171 | 7/35 (20%) | |
Ank_4 | 143..193 | CDD:290365 | 8/52 (15%) | ||
ANK | 167..292 | CDD:238125 | 25/137 (18%) | ||
ANK 2 | 172..201 | 3/28 (11%) | |||
ANK repeat | 174..203 | CDD:293786 | 2/28 (7%) | ||
Ank_2 | 177..269 | CDD:289560 | 17/94 (18%) | ||
ANK repeat | 205..236 | CDD:293786 | 8/30 (27%) | ||
ANK 3 | 205..234 | 7/28 (25%) | |||
ANK | 233..357 | CDD:238125 | 19/82 (23%) | ||
ANK repeat | 238..269 | CDD:293786 | 8/33 (24%) | ||
ANK 4 | 238..267 | 8/31 (26%) | |||
Ank_2 | 243..335 | CDD:289560 | 17/72 (24%) | ||
ANK repeat | 271..302 | CDD:293786 | 8/39 (21%) | ||
ANK 5 | 271..300 | 7/37 (19%) | |||
ANK repeat | 304..335 | CDD:293786 | |||
ANK 6 | 304..333 | ||||
ANK 7 | 337..373 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 369..494 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5277 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100127 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.710 |