DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and Actr3b

DIOPT Version :9

Sequence 1:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001178789.1 Gene:Actr3b / 362298 RGDID:1565759 Length:418 Species:Rattus norvegicus


Alignment Length:417 Identity:151/417 - (36%)
Similarity:224/417 - (53%) Gaps:61/417 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVDNGSGMCKAGFAGDDAPRAVFPS---------IVGRPRHQGVMVGMGQKDCYVGDEAQSKRGI 65
            |||.|:|..|.|:||:..|:.:.||         :|.:.:.: |:.|:...|.::||||..| ..
  Rat     9 VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR-VLRGVDDLDFFIGDEAIDK-PT 71

  Fly    66 LSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNS 130
            .:.|:||.|||:.:||.||:......:..||..||:|..|:||.|||...|||.:.:||||:||.
  Rat    72 YATKWPIRHGIVEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNV 136

  Fly   131 PAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 187
            |.:|:|:||||:|.||       .|| ||||:||||||:|.:|:.|||.:...|..:.:||||:|
  Rat   137 PGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDIT 201

  Fly   188 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA-------------TAAASTSLEK 239
            .::.::|.||..........|..:.||||.||:..|..:|.|             |...:.:..|
  Rat   202 YFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQRK 266

  Fly   240 SYELPDGQVITIGNERFRTPEALFQPSFLG---MESCGIHETVYQSIMKCDVDIRKDLYANNVLS 301
            .       :|.:|.|||..||..|.|.|..   |||  |.:.|.:.|..|.:|:|:.||.|.|||
  Rat   267 F-------IIDVGYERFLGPEIFFHPEFANPDFMES--ISDVVDEVIQNCPIDVRRPLYKNIVLS 322

  Fly   302 GGTTMYPGIADRMQKEIT----------------ALAPSTIKIKIIAPPERKYSVWIGGSILASL 350
            ||:||:.....|:|:::.                .:.|..:::::|....::|:||.|||:|||.
  Rat   323 GGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGRIKPKPVEVQVITHHMQRYAVWFGGSMLAST 387

  Fly   351 STFQQMWISKQEYDESGPGIV-HRKCF 376
            ..|.|:..:|::|:|.||.|. |...|
  Rat   388 PEFFQVCHTKKDYEEYGPSICRHNPVF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 150/415 (36%)
Actr3bNP_001178789.1 PTZ00280 2..417 CDD:240343 151/417 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.