DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and ACTL10

DIOPT Version :9

Sequence 1:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001019846.1 Gene:ACTL10 / 170487 HGNCID:16127 Length:245 Species:Homo sapiens


Alignment Length:243 Identity:80/243 - (32%)
Similarity:139/243 - (57%) Gaps:7/243 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGY 199
            :|..|:|:|.::|..:|:.:::|.||.|..|||.|::...|..||::||..|:.||..:|.....
Human     1 MASTALLALCSTGAFSGLAVEAGAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLLVAANP 65

  Fly   200 SFTTTA-EREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRTPEALF 263
            .....| .|:.:..:|::.|||:||||.::...|...  ..|:.:.:|..:.:.:||||.||.:|
Human    66 DLLQQALPRKAITHLKKRSCYVSLDFEGDLRDPARHH--PASFSVGNGCCVCLSSERFRCPEPIF 128

  Fly   264 QPSFLGMESCGIHETVYQSIMKCDVDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAP----S 324
            ||..||....|:....::::.|....:|..|....||:||:|::||.|:|:.||:.|...    :
Human   129 QPGLLGQAEQGLPALAFRALQKMPKTLRTRLADTVVLAGGSTLFPGFAERLDKELEAQCRRHGYA 193

  Fly   325 TIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVH 372
            .::..::|...|..:||.|||::|||.:||:.||::..|.|.|..:::
Human   194 ALRPHLVAKHGRGMAVWTGGSMVASLHSFQRRWITRAMYQECGSRLLY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 80/243 (33%)
ACTL10NP_001019846.1 NBD_sugar-kinase_HSP70_actin <2..237 CDD:327376 79/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.