DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and ACTL7B

DIOPT Version :9

Sequence 1:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_006677.1 Gene:ACTL7B / 10880 HGNCID:162 Length:415 Species:Homo sapiens


Alignment Length:369 Identity:161/369 - (43%)
Similarity:229/369 - (62%) Gaps:5/369 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQSKRGILSLKYPI 72
            |:::|.||..||.|:||:..|.....|.||:...:....|..:|...||.|..:....|.|..|:
Human    51 AVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPL 115

  Fly    73 EHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAI 137
            :|||:.:||.::.:|.:.|...:::.||||.||:::.||:|.:||||..::|||||..|||:|..
Human   116 KHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTS 180

  Fly   138 QAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFT 202
            |::||:|:.|:|:|:|::||.||||.|||.||..||....|.|.||.|||:|||::|.|.|::||
Human   181 QSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFT 245

  Fly   203 TTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRTPEALFQPSF 267
            .. ...|:..||:|.||.|...|:|:  ......|...||||||::||||.||||..|.|||||.
Human   246 DD-HLHIIEHIKKKCCYAAFLPEEEL--GLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSL 307

  Fly   268 LGMESCGIHETVYQSIMKC-DVDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTIKIKII 331
            .|....|:.|.....:.:| |...::::.||.:|.||.||..|..:|.|:|::.|.|.. ...:.
Human   308 AGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGD-SPAVA 371

  Fly   332 APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKC 375
            |.||||.|||.||||||||..|||:|:||:|::|.|...::.||
Human   372 AAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 161/369 (44%)
ACTL7BNP_006677.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
NBD_sugar-kinase_HSP70_actin 51..415 CDD:327376 159/367 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.