DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and LOC100288966

DIOPT Version :9

Sequence 1:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001244291.1 Gene:LOC100288966 / 100288966 -ID:- Length:584 Species:Homo sapiens


Alignment Length:245 Identity:49/245 - (20%)
Similarity:100/245 - (40%) Gaps:48/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EAQSKRGILSLKYPIEHGIITNWDDM--EKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120
            :.|....:|.|   :|||...|..|.  ....|:..|||.::..:  .:||..|.:..| |:..:
Human   215 QCQEDECVLML---LEHGADRNIPDEYGNTALHYAIYNEDKLMAK--ALLLYGADIESK-NKCGL 273

  Fly   121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYA-LPHAIL--RLDLA 182
            |.::.      .::...|.|:......:....|||.....:..:.:..|.| :.:.:|  .:|::
Human   274 TPLLL------GVHEQKQQVVKFLIKKKANLNVLDRYGRTALILAVCCGSASIVNLLLEQNVDVS 332

  Fly   183 GRDLTDYLMKILTERGYSFTTTAE--REIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPD 245
            .:||:..     |.|.|:.::...  .|::.|.|||         |.:..::.:::.|:..:|..
Human   333 SQDLSGQ-----TAREYAVSSHHHVICELLSDYKEK---------QMLKISSENSNPEQDLKLTS 383

  Fly   246 GQVITIGNERFRTPEALFQPSFLGMESCGIHETVYQSIMK-CDVDIRKDL 294
            .:    .::|.:..|. .||..:..|         ..|.| ||.::.:::
Human   384 EE----ESQRLKVSEN-SQPEKMSQE---------PEINKDCDREVEEEI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 49/245 (20%)
LOC100288966NP_001244291.1 Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125 20/88 (23%)
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560 16/59 (27%)
ANK repeat 205..236 CDD:293786 7/23 (30%)
ANK 233..357 CDD:238125 27/137 (20%)
ANK repeat 238..269 CDD:293786 8/33 (24%)
Ank_2 243..335 CDD:289560 19/100 (19%)
ANK repeat 271..302 CDD:293786 4/36 (11%)
ANK repeat 304..335 CDD:293786 4/30 (13%)
SH3_and_anchor <440..556 CDD:275056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.