DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act79B and actr3b

DIOPT Version :9

Sequence 1:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_005162538.1 Gene:actr3b / 100038776 ZFINID:ZDB-GENE-070424-10 Length:419 Species:Danio rerio


Alignment Length:417 Identity:146/417 - (35%)
Similarity:220/417 - (52%) Gaps:61/417 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDCYVGDEAQSKRGIL 66
            |:|.|:|..|.|:||:..|:.:.|:.        ||....:.::.|:...|.::||||..|.. .
Zfish    10 VIDCGTGYTKIGYAGNTEPQFIMPTCIAVRESASVGDQAQRRLVKGVDDLDFFIGDEAIDKPN-Y 73

  Fly    67 SLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSP 131
            :.|:||.||||.:||.|||......:..||..||:|..|:||.|||...|||.:.:|||||||.|
Zfish    74 ATKWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFETFNVP 138

  Fly   132 AMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 188
            .:|:|:||||:|.||       .|| ||||:||||||:|.:|:.|||.:...|..:.:||||:|.
Zfish   139 GLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHAIPVAEGYVIGSCIKHIPIAGRDITY 203

  Fly   189 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQ------ 247
            ::.::|.||..........|..:.:||:.||:..|..:|..          .|::..|:      
Zfish   204 FIQQLLREREIGIPPEQSLETAKAVKERYCYICPDIVKEFT----------KYDMDPGKWIKKYK 258

  Fly   248 ----------VITIGNERFRTPEALFQPSFLGMESC-GIHETVYQSIMKCDVDIRKDLYANNVLS 301
                      .|.:|.|||..||..|.|.|...:.. .|.:.|.:.|..|.:|:|:.||.|.|||
Zfish   259 GINAISKNEFQIDVGYERFLGPEIFFHPEFANPDFMQPISDVVDEVIQNCPIDVRRPLYKNIVLS 323

  Fly   302 GGTTMYPGIADRMQKEIT----------------ALAPSTIKIKIIAPPERKYSVWIGGSILASL 350
            ||:||:.....|:|:::.                .:.|..:::::|:...::|:||.|||:|||.
Zfish   324 GGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPMEVQVISHHMQRYAVWFGGSMLAST 388

  Fly   351 STFQQMWISKQEYDESGPGIV-HRKCF 376
            ..|.|:..:|::|:|.||.|. |...|
Zfish   389 PEFFQVCHTKKDYEEYGPRICRHNPVF 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 145/415 (35%)
actr3bXP_005162538.1 COG5277 1..411 CDD:227602 144/411 (35%)
PTZ00280 3..416 CDD:240343 146/417 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.