DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7470 and pyrH

DIOPT Version :9

Sequence 1:NP_001246877.1 Gene:CG7470 / 40443 FlyBaseID:FBgn0037146 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_414713.1 Gene:pyrH / 944989 ECOCYCID:EG11539 Length:241 Species:Escherichia coli


Alignment Length:306 Identity:66/306 - (21%)
Similarity:118/306 - (38%) Gaps:98/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RRLVVKLGSAVITREDNHGL---ALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQ--- 115
            :|:::||....:...:..|:   .|.|:|..::::.|.   |.:|.:|..|...|....||:   
E. coli    10 KRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVEL---GIQVGVVIGGGNLFRGAGLAKAGM 71

  Fly   116 ------------ELLMSLSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKI 168
                        .::..|:||:.|:        .|.:..|..:|:..:|:...|           
E. coli    72 NRVVGDHMGMLATVMNGLAMRDALH--------RAYVNARLMSAIPLNGVCDSY----------- 117

  Fly   169 AQVLVTKPDFYNEETRNNLFCTLSELISL---NIVPIINTNDAVSPPMFIRDDEPAGGARRGIPI 230
                                 :.:|.|||   |.|.|::                   |..|.|.
E. coli   118 ---------------------SWAEAISLLRNNRVVILS-------------------AGTGNPF 142

  Fly   231 KDNDSLSAMLAAEVQADLLILMSDVDGIYNKPPWEDGAKLMH---TYTSDDSNSIEFGKKSKVGT 292
            ...||.:.:...|::||:::..:.|||::...|.:|....|:   ||    |..:|  |:.||  
E. coli   143 FTTDSAACLRGIEIEADVVLKATKVDGVFTADPAKDPTATMYEQLTY----SEVLE--KELKV-- 199

  Fly   293 GGMDSKVKAATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTE 338
              ||  :.|.|.|.|..:.:.:.|..:..|::.::.|.|.||..||
E. coli   200 --MD--LAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7470NP_001246877.1 AAK_P5CS_ProBA 49..337 CDD:239789 64/303 (21%)
P5CS 50..775 CDD:130164 66/306 (22%)
ALDH_F18-19_ProA-GPR 349..753 CDD:143398
pyrHNP_414713.1 AAK_UMPK-PyrH-Ec 10..240 CDD:239787 64/303 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.