DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7470 and SPAC17H9.13c

DIOPT Version :9

Sequence 1:NP_001246877.1 Gene:CG7470 / 40443 FlyBaseID:FBgn0037146 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_593583.1 Gene:SPAC17H9.13c / 2542273 PomBaseID:SPAC17H9.13c Length:402 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:96/296 - (32%)
Similarity:145/296 - (48%) Gaps:45/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VSPERRLEKAHPTFTERSQLKYARRLVVKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREV 98
            :||:.:  ..:.|:|          :|:|||::.|..|..|...:..|:.|||.|.:....|..|
pombe     1 MSPKSK--STNKTYT----------IVIKLGTSSICDEKTHEPLISNLSLIVETVVKLRKLGHNV 53

  Fly    99 MMVTSGAVAFGKQKLAQELLMSLSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQ 163
            ::|:||.:|.|.::|  :|           ||...:....    :|.|||||..|:||:|.:|.|
pombe    54 VLVSSGGIAMGLRRL--DL-----------PKRPSKLSAV----QAIAAVGQGRLISLWDTLFTQ 101

  Fly   164 YGVKIAQVLVTKPDFYNEETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGI 228
            ....|||||:|:.|........|...|:|||:...:|||:|.||.:|.              :.|
pombe   102 LRQPIAQVLITRNDIAERSQYVNAANTISELLHFGVVPIVNENDTLSV--------------QEI 152

  Fly   229 PIKDNDSLSAMLAAEVQADLLILMSDVDGIYNKPPW--EDGAKLMHTYTSDDSNSIEFGKKSKVG 291
            ...|||:|||:.|..:.||.|.|::|||.:|...|.  .|...::..:.:...|:......|.||
pombe   153 RFGDNDTLSAITAGMINADYLFLLTDVDCLYTDNPRTNPDAKPILKIHDTSMVNANVSTPGSGVG 217

  Fly   292 TGGMDSKVKAATWALDRGVSVVICNGMQEKAIKTII 327
            ||||.:|:.||......||:|:||.|.:..:|..||
pombe   218 TGGMKTKLIAADLGTSSGVNVIICRGSKPSSIFDII 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7470NP_001246877.1 AAK_P5CS_ProBA 49..337 CDD:239789 92/281 (33%)
P5CS 50..775 CDD:130164 92/280 (33%)
ALDH_F18-19_ProA-GPR 349..753 CDD:143398
SPAC17H9.13cNP_593583.1 ProB 6..387 CDD:223341 94/291 (32%)
AAK_G5K_ProB 13..274 CDD:239775 93/282 (33%)
PUA 296..370 CDD:279774
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1411
eggNOG 1 0.900 - - E1_COG0263
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.