DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and SV2A

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001315603.1 Gene:SV2A / 9900 HGNCID:20566 Length:742 Species:Homo sapiens


Alignment Length:680 Identity:133/680 - (19%)
Similarity:219/680 - (32%) Gaps:244/680 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DSPSSVYEEDWLGFTIPKKNSAWDDCHRYA-----ANISDAISGYTDPSG-----------QYCL 138
            |....:||.::.|  ||:..|.... .|.|     |.:...:|....|.|           :...
Human    88 DEDDEIYEGEYQG--IPRAESGGKG-ERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELA 149

  Fly   139 KEYFTITSETCGR-------------------------DFKFRDEEKTISTEFGIYCEDEWKLSM 178
            ::|..|..| ||.                         .|.....||.:       |..:....|
Human   150 QQYEAILRE-CGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDM-------CLSDSNKGM 206

  Fly   179 VGTINNVGQFVGIPLGGYFADRYGRRTMLAVAGSVSALMGVIRSLSSNYSMFLVFEFLD-MAVGS 242
            :|.|..:|..||..|.|..|||.|||..|.::.||:::.....|....|..||....|. :.:|.
Human   207 LGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGG 271

  Fly   243 TLFPTAFLLAIELVGPKRRVAAATIITIFYALGEAFLGFL----------------ASQVQHWRW 291
            :: |..|....|.:..::|....:.:.:|:.:|..:...:                |.|...||.
Human   272 SI-PIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRV 335

  Fly   292 LLRVLYAPAVLQILFLWILPESVRWLLSQGAEEKASNVLRRAARINQRPL--PEE--QLNDLLTS 352
            .:.|...|:|..|..|...|||.|:.|..|..::|..||::....|.|..  ||.  .:..:.|.
Human   336 FVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTI 400

  Fly   353 NRQ----KLSQANESQY-----------------------PIMRAVVFFSLRIANCCLCWFTHTL 390
            :::    ::.....:.|                       |..|.:....:.:      |||.:.
Human   401 HQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRITLMMMGV------WFTMSF 459

  Fly   391 IALGLSL------------------------------------NSVNLGGN-------------- 405
            ...||::                                    |.::.||.              
Human   460 SYYGLTVWFPDMIRHLQAVDYASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSV 524

  Fly   406 ----------------------------------------KYTN-------FMLNG--------- 414
                                                    |:.|       |:.|.         
Human   525 SFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTG 589

  Fly   415 ---------FIQ-------IPGLLLPLVIMDRVGRRHSLC-ASMLLCAICMGASAAVPADNYAGS 462
                     |:.       :||.::..::||::||...|. :|::.|..|...|.   .::.:..
Human   590 TGEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSF---GNSESAM 651

  Fly   463 LALF-LIGKLAITCSFQILYFFTSEIFPTNVRNT----LLSLCSMVGRIGSMLAPQTPLLAKYYI 522
            :||. |.|.::| .|:..|...|.|::|::.|.|    |.:||.:...:|..:......:.|   
Human   652 IALLCLFGGVSI-ASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITK--- 712

  Fly   523 YAPQILFATFALISG-FLTLAFPETADKVL 551
             |..||||:.||..| .|.|..|||..:||
Human   713 -AAPILFASAALALGSSLALKLPETRGQVL 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 133/680 (20%)
MFS 161..544 CDD:119392 107/559 (19%)
SV2ANP_001315603.1 synapt_SV2 1..742 CDD:130366 133/680 (20%)
Interaction with SYT1. /evidence=ECO:0000250 1..57
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..144 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.