DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and SLC22A14

DIOPT Version :10

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_006713479.2 Gene:SLC22A14 / 9389 HGNCID:8495 Length:675 Species:Homo sapiens


Alignment Length:112 Identity:24/112 - (21%)
Similarity:37/112 - (33%) Gaps:44/112 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 VENQNRTVNRD------DVNDKSPTSVMENEDLNRSSLPKSISVRSNGYSKASQGGGGAAAQSGK 178
            |:...|.::.|      |:.||     ||..|..                  |.||.|..    |
Human   153 VDKHIRRLDADLARFEADLKDK-----MEGSDFE------------------SSGGRGLK----K 190

  Fly   179 PRGTVTKPGTCGQVSTTKVYVRGGGKKEDQEEEIEVEVYNQGMTKTE 225
            .||...|.|:           ||.|::..:|:..:.:.:..|...|:
Human   191 GRGQKEKRGS-----------RGRGRRTSEEDTPKKKKHKGGSEFTD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 MFS_SLC22 150..544 CDD:340875 15/76 (20%)
SLC22A14XP_006713479.2 MFS_OAT 229..641 CDD:340932
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.