DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and PHT1;9

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_177769.1 Gene:PHT1;9 / 843976 AraportID:AT1G76430 Length:532 Species:Arabidopsis thaliana


Alignment Length:493 Identity:96/493 - (19%)
Similarity:170/493 - (34%) Gaps:154/493 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 HRYAANISDAISGYTDPSGQYCLKEYFTITSETCGRDFKFRDEEKT--ISTEFGIYCEDEWKLSM 178
            :.:.|.|...:..:||....:|:.....:.|:.    :..:|...|  :||.:.|        ::
plant    18 YHFKAIIVAGMGLFTDAYDLFCIAPIMKMISQI----YYHKDSIGTALLSTSYAI--------AL 70

  Fly   179 VGTINNVGQFVGIPLGGYFADRYGRRTMLAVAGSVSALMGVIRSLSSNYSMFLV----------- 232
            :||.  :||.:    .||..||.|||.:.    .:|.|:.|..|....:|:...           
plant    71 LGTA--LGQLI----FGYLGDRVGRRKVY----GLSLLIMVFSSFGCGFSVCTTRRSCVMVSLGF 125

  Fly   233 FEF-LDMAVGSTLFPTAFLLAIELVGPKRRVAAATIITIFYALGEAFLGFLASQVQ--------- 287
            |.| |.:.:|.. :|.:..:..|..  .:|...|.|..:|...|   ||.|.|...         
plant   126 FRFVLGLGIGGD-YPLSATIMSEFA--NKRTRGAFIAAVFSMQG---LGILMSSAVTMVVCLAFK 184

  Fly   288 -------------------------HWRWLLRVLYAPAVLQILFLWILPESVRWLLSQGAEEKAS 327
                                     .||.:|.:...||.|...:..::||:.|:      .....
plant   185 NAGEGSSEKTNVAGLETLAPPESDIAWRLILMIGALPAALTFYWRMLMPETARY------TALVE 243

  Fly   328 NVLRRAARINQRPLPEEQLNDLLTSNRQKLSQ-ANESQYPIMRAVVFFSLRI------------A 379
            |.:.:||:..||.:....::.:...:..:|.| .:.|.|.:      ||.|.            |
plant   244 NNVVQAAKDMQRVMSVSMISQITEDSSSELEQPPSSSSYKL------FSRRFLSLHGRDLFAASA 302

  Fly   380 NCCLCWF-------THTLIALGL------SLNSVNLGGNKYTNFMLNGFI----QIPGLLLPLVI 427
            |    ||       |..|:...:      .|||.|:..:.:....|...:    .|||....:..
plant   303 N----WFLVDVVFYTSNLLLSQIFNFSNKPLNSTNVYDSAFEVAKLAAIVAACSTIPGYWFTVYF 363

  Fly   428 MDRVGRRHSLCASMLLCAICMGASAAVPADNY--------AGSLALFLIGKLAITCSFQILYFFT 484
            :|::||.........|.|: :...|.:|...|        .|.:.|           :.:::||:
plant   364 IDKIGRVKIQMMGFFLMAV-VYLVAGIPYSWYWSKHEKTNKGFMVL-----------YGLIFFFS 416

  Fly   485 ------------SEIFPTNVRNTLLSLCSMVGRIGSML 510
                        :|:||...|:|...:....|:.|:::
plant   417 NFGPNTTTFIIPAELFPARFRSTCHGISGAAGKFGAIV 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 96/493 (19%)
MFS 161..544 CDD:119392 89/448 (20%)
PHT1;9NP_177769.1 2A0109 7..509 CDD:129965 96/493 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D762280at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.