DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and PGLCT

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_568328.1 Gene:PGLCT / 831472 AraportID:AT5G16150 Length:546 Species:Arabidopsis thaliana


Alignment Length:442 Identity:102/442 - (23%)
Similarity:169/442 - (38%) Gaps:110/442 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 WKLSMVGTINNVGQFVGIPLGGYFADRYGR-RT-------------MLAVAGSVSALMGVIRSLS 224
            |.:|.:.....||.|.    ||..||::|| ||             :.|.|.||..:: |.|.|:
plant   148 WIVSSLLAGATVGSFT----GGALADKFGRTRTFQLDAIPLAIGAFLCATAQSVQTMI-VGRLLA 207

  Fly   225 SNYSMFLVFEFLDMAVGSTLFPTAFLLAIELVGPKR-RVAAATIITIFYALG---EAFLGF-LAS 284
            .          :.:.:.|.:.|    |.|..:.|.. |.|..::..:|..:|   ....|. ||:
plant   208 G----------IGIGISSAIVP----LYISEISPTEIRGALGSVNQLFICIGILAALIAGLPLAA 258

  Fly   285 QVQHWRWLLRVLYAPAVLQILFLWILPESVRWLLSQG---AEEKASNVLRRAARINQ--RPL--- 341
            ....||.:..|...|:||..:.:...|||.|||:.||   ..|||...|....|:.:  |.|   
plant   259 NPLWWRTMFGVAVIPSVLLAIGMAFSPESPRWLVQQGKVSEAEKAIKTLYGKERVVELVRDLSAS 323

  Fly   342 ------PEEQLNDLLTSNRQKLSQANES-----QYPIMRAVVFFSLRIANCCLCWFTHTLIALGL 395
                  ||....||.:|...|:.....:     |...:.|||::|..:       |....|...:
plant   324 GQGSSEPEAGWFDLFSSRYWKVVSVGAALFLFQQLAGINAVVYYSTSV-------FRSAGIQSDV 381

  Fly   396 SLNSVNLGGNKYTNFMLNGFIQIPGLLLPLVIMDRVGRRH-------SLCASMLLCAICMGASAA 453
            :.::            |.|...:.|..:...:||::||:.       .:..||||.::.....|.
plant   382 AASA------------LVGASNVFGTAVASSLMDKMGRKSLLLTSFGGMALSMLLLSLSFTWKAL 434

  Fly   454 VPADNYAGSLALFLIGKLAITCSFQ-----ILYFFTSEIFPTNVRNTLLSLCSMVGRIGSMLAPQ 513
            ..   |:|:||  ::|.:....||.     :......|||.:.:|...::|...:..|.:.    
plant   435 AA---YSGTLA--VVGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAVALSLGMHWISNF---- 490

  Fly   514 TPLLAKYYI-----YAPQILFATFALISGFLTLAFPETADKVLPT---TIEE 557
              ::..|::     :....::..||   |...||....|..|:.|   ::||
plant   491 --VIGLYFLSVVTKFGISSVYLGFA---GVCVLAVLYIAGNVVETKGRSLEE 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 100/437 (23%)
MFS 161..544 CDD:119392 97/424 (23%)
PGLCTNP_568328.1 MFS 109..524 CDD:119392 97/427 (23%)
Sugar_tr 111..539 CDD:278511 102/442 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.