DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and AT3G19940

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_188628.1 Gene:AT3G19940 / 821532 AraportID:AT3G19940 Length:514 Species:Arabidopsis thaliana


Alignment Length:431 Identity:88/431 - (20%)
Similarity:165/431 - (38%) Gaps:64/431 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 YCE-DEWKLSMVGTINNVGQFVGIPLGGYFADRYGRRTMLAVAGSVSALMGVIRSLSSNYSMFLV 232
            ||: |...|.:..:...:...|...:......::||:..:.:.|....:..:..:.:.|.||.::
plant    76 YCKFDNQMLQLFTSSLYLAALVASFMASVITRKHGRKVSMFIGGLAFLIGALFNAFAVNVSMLII 140

  Fly   233 FE-FLDMAVGSTLFPTAFLLAIELVGPKRR----VAAATIITIFYALGEAFLGFLASQVQH-WRW 291
            .. .|.:.||.....|...|: |:...|.|    :.....|||...:........:...|| ||.
plant   141 GRLLLGVGVGFANQSTPVYLS-EMAPAKIRGALNIGFQMAITIGILVANLINYGTSKMAQHGWRV 204

  Fly   292 LLRVLYAPAVLQILFLWILPESVRWLLSQGAEEKASNVLRRAARINQRPLPEEQLNDLLTSNRQK 356
            .|.:...|||:.::..:|||::...:|.:|..|:|..:|:   :|......:.:..||:.:....
plant   205 SLGLAAVPAVVMVIGSFILPDTPNSMLERGKNEEAKQMLK---KIRGADNVDHEFQDLIDAVEAA 266

  Fly   357 LSQAN------ESQY-PIM---RAVVFFSLRIANCCLCWFTHTLI-ALGLSLNSVNLGGNKYTNF 410
            ....|      ||:| |.:   .|:.||........:.::...|. .||...::..:..      
plant   267 KKVENPWKNIMESKYRPALIFCSAIPFFQQITGINVIMFYAPVLFKTLGFGDDAALMSA------ 325

  Fly   411 MLNGFIQIPGLLLPLVIMDRVGRRHSLC---ASMLLCAICMGA-----------SAAVP--ADNY 459
            ::.|.:.:....:.:..:||.|||....   ..|.:|.:.:|:           ....|  ||..
plant   326 VITGVVNMLSTFVSIYAVDRYGRRLLFLEGGIQMFICQLLVGSFIGARFGTSGTGTLTPATADWI 390

  Fly   460 AGSLALFLIGKLAITCSFQIL-YFFTSEIFPTNVRNTLLSLCSMVGRIGSMLAPQTPL------- 516
            ...:.:::.|   ...|:..| :...|||.|..:|....::...|....:.|..|..|       
plant   391 LAFICVYVAG---FAWSWGPLGWLVPSEICPLEIRPAGQAINVSVNMFFTFLIGQFFLTMLCHMK 452

  Fly   517 LAKYYIYAPQILFATFALISGFLTLAFPETADKVLPTTIEE 557
            ...:|.:|..:     |:::.|:....|||  |.:|  |||
plant   453 FGLFYFFASMV-----AIMTVFIYFLLPET--KGVP--IEE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 85/426 (20%)
MFS 161..544 CDD:119392 80/416 (19%)
AT3G19940NP_188628.1 Sugar_tr 29..489 CDD:278511 88/431 (20%)
MFS 79..475 CDD:119392 78/413 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.