DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and slc2a13b

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_005163236.1 Gene:slc2a13b / 559440 ZFINID:ZDB-GENE-090812-1 Length:641 Species:Danio rerio


Alignment Length:480 Identity:110/480 - (22%)
Similarity:179/480 - (37%) Gaps:149/480 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 GGYFADRYGRRTMLAVAGSVSALMGVIRSLSSNYSMFLVFEF---LDMAVGSTLFPTAFLLAIEL 255
            ||:...|:|||..:.:|..:....|:|.|::.|....|....   |.:.:.|...|   :...|:
Zfish    92 GGFLNGRFGRRVCILLASFIFCAGGIILSVARNKEALLCGRLTVGLGLGIASMTVP---VYIAEV 153

  Fly   256 VGPKRRVAAATIITIFYALGEAFLGFLASQVQ-------H--WRWLLRVLYAPAVLQILFLWILP 311
            ..|..|....|:.|:|...|:    |:||.|.       |  ||::|.:...||.||.|....||
Zfish   154 SPPDLRGQLVTVNTLFITGGQ----FIASVVDGAFSYLPHDGWRFMLGLSVVPAALQFLGFLFLP 214

  Fly   312 ESVRWLLSQGAEEKASNVLRRAARINQRPLPEEQLNDLLTSNRQKLSQANESQYPIM-------- 368
            ||.||||.:|..:.|..|||   :|......||:...:..|.:::  |.:.:..|::        
Zfish   215 ESPRWLLQKGFTQNALLVLR---QIRGDVDVEEEFESIRCSIQEE--QRDVAGGPVLWRMLASPP 274

  Fly   369 --RAVV-------FFSLRIANCCLCWFTHTLIAL-GLSLNSVNL---GGNKYTNFMLNGFIQIPG 420
              ||::       |..|...|..: :::.|::.: |:..:.:.:   .|..:|||:..       
Zfish   275 ARRALIVGCGLQMFQQLAGINTVM-YYSATILQMSGVQDDQMAIWLAAGTAFTNFLFT------- 331

  Fly   421 LLLPLVIMDRVGRR-----------------------------------------------HSLC 438
             |:.:.:::|||||                                               :..|
Zfish   332 -LVGVWLVERVGRRRLTMASLLGTAVSLMVLAAGFLLSAQASPPVTFHPSNPSIHNSTCGNYGFC 395

  Fly   439 ASMLL---CAICMGASAAV----------PADNYAGSLALFLIGKLAITCSF------------- 477
            .|.:|   |..|.|.:|..          ||:....:|.....|....:..|             
Zfish   396 ESCMLDPDCGFCYGLNATAVVQSSCVPVDPANTETAALGRCFNGTQKASSVFWAYNYCPTPYSWV 460

  Fly   478 ----QILY--FF-----------TSEIFPTNVRNTLLSLCSMVGRIGSMLAPQTPLLAKYYI--Y 523
                .|||  ||           .|||:|...|:|..:..:.|..|.::|...|.|....|:  |
Zfish   461 VLLGLILYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWICNVLVSLTFLHVAQYLTYY 525

  Fly   524 APQILFATFALISGFLTLA--FPET 546
            ....|:|..||: ||:.::  .|||
Zfish   526 GAFFLYAALALL-GFVFVSGCLPET 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 110/480 (23%)
MFS 161..544 CDD:119392 107/476 (22%)
slc2a13bXP_005163236.1 Sugar_tr 38..561 CDD:278511 110/480 (23%)
MFS 40..542 CDD:119392 107/471 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.