DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and svopb

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_021327288.1 Gene:svopb / 555216 ZFINID:ZDB-GENE-070705-359 Length:266 Species:Danio rerio


Alignment Length:224 Identity:52/224 - (23%)
Similarity:95/224 - (42%) Gaps:41/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 CLCWFTHTLIALGL--------------------------SLNSVNLGGNKYTNFMLNGFIQIPG 420
            |: ||....:..||                          ||...:|..:.|.:.:...|.:.||
Zfish    40 CI-WFFSAFLYYGLVLLTTELFQAGSACGVTENSNIEHQCSLMCQHLTIDDYLDLLWTTFAEFPG 103

  Fly   421 LLLPLVIMDRVGRRHSLCASMLLCAICMGASAAVPADNYAGS----LALFL-IGKLAITCSFQIL 480
            ||:.|.:::|:.||.|:.....|..:|:     :|.  ||.:    |.:|: |.:.:|...:||.
Zfish   104 LLVALWMVNRISRRKSMVICFSLFTVCI-----LPL--YACTHRIVLTVFIFIARTSINAGWQIA 161

  Fly   481 YFFTSEIFPTNVRNTLLSLCSMVGRIGSMLAP-QTPLLAKYYIYAPQILFATFALISGFLTLAFP 544
            |.:|.|:|||..|...:...|.:.|:|:::.| ...:|.|..:|....::..|.|:......|.|
Zfish   162 YVYTPEVFPTATRAIGIGTSSGMSRVGALVTPFIAQVLLKSSVYLTLSVYLIFGLLGTAACWALP 226

  Fly   545 -ETADKVLPTTIEEARDLNQAKRRSERSP 572
             ||..:.|..:.:.:.:....::..:..|
Zfish   227 METEGRSLQESTQSSMEQKHTEKTHDSEP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 51/204 (25%)
MFS 161..544 CDD:119392 47/193 (24%)
svopbXP_021327288.1 Sugar_tr <23..236 CDD:331684 51/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.