DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and CG12783

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001262644.2 Gene:CG12783 / 42019 FlyBaseID:FBgn0038448 Length:493 Species:Drosophila melanogaster


Alignment Length:426 Identity:91/426 - (21%)
Similarity:160/426 - (37%) Gaps:103/426 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 CEDEWKLSMVGTINNVGQFVGIPLG----GYFADRYGRRTMLAVAGSVSALMGVIRSLSSNYSMF 230
            |:.....:.:.::...| |:||...    ||..|:.|||..|....::|.|..:....:..::.|
  Fly    47 CDLRMNEAQLASLTAAG-FMGIICSSYFWGYITDKKGRRWTLLRTITISNLCSLASMFTVTFTGF 110

  Fly   231 LVFEFLD-MAVGSTLFPTAFLLAIELVGPKRRVAAATII---------------TIFYALG---- 275
            .|..|:. :.|....|..|..|: |....:..|.:.|.:               |:|.:.|    
  Fly   111 FVMRFITCIFVAGPSFVAATYLS-EFCSHRIMVRSITHLYMFTGFAMISCPAWATLFLSSGLIEF 174

  Fly   276 -EAFLGFLASQVQHWRWLLRVLYAPAVLQILFLWILPESVRWLLSQGAEEKASNVLRRAARINQ- 338
             |..:|.|.  ::.||.|..:...|.|:..|.|.:||||.::||..|..::..:.:...:|.|. 
  Fly   175 EEKLVGSLT--LRPWRVLGCLYILPGVVAFLLLLLLPESPKFLLMIGETKRGLDTMEWISRKNTG 237

  Fly   339 RPLPEEQLNDLLT-SNRQKLSQANESQ----------YPIMRAVV--FFSLRIANCCLCWFTHTL 390
            |.|.|:|:..||. ....::.:..|.|          .|::|...  :|:      |:|.   .:
  Fly   238 RTLSEDQMKRLLAYQEHVQVKRRKEHQNFFRSMLDDAMPLVRKPYGGYFT------CVCM---VM 293

  Fly   391 IALGLSLNSVNLGGNKYTNFMLNGFIQIPGLLLPLVIMDRVGRRHSLCASMLLCAICMGASA--- 452
            ..|||..:.:   |..||                 .:.:|...|......|..|.:......   
  Fly   294 FVLGLLTHGL---GIWYT-----------------AMRNRCNMRQGNTNGMTFCQVLFVPETGPF 338

  Fly   453 --------AVPADNYAGSLALFLIGKLAITCSFQILYFFTSEIFPTNVR-NTLLSLCSMVGRIGS 508
                    .|.:|::.|....|::|.:     :.:||         |:. .:|..:...|..:.|
  Fly   339 IETESDLDVVCSDSFKGFNDSFVLGFV-----YVVLY---------NISWASLFCVHKKVMFVFS 389

  Fly   509 MLAPQTPLLAKYYIYAPQILFATFALISGFLTLAFP 544
            ::|..|  .....|:|...:...|:|:  || :|||
  Fly   390 LVASST--FGFLLIFATNHMLQLFSLV--FL-IAFP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 91/426 (21%)
MFS 161..544 CDD:119392 89/424 (21%)
CG12783NP_001262644.2 synapt_SV2 <2..>310 CDD:130366 65/295 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.