DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and CG4324

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:408 Identity:98/408 - (24%)
Similarity:188/408 - (46%) Gaps:57/408 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 IYCEDEWKLS--MVGTINNVGQFVGIPLGGYF----ADRYGRRTMLAVAGSVSALMGVIRSLSSN 226
            ::|  ||.::  ...::..| .|:|:.|...|    ::||||::.|.:.|.:..|..::.|::.:
  Fly    83 LFC--EWNVTKFQQASVTTV-VFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPS 144

  Fly   227 YSMFLVFE-FLDMAVGSTLFPTAFLLAIELVGPKRRVAAATIITIFYALGEAF---LGFLASQVQ 287
            |:..|... .:..|:|..  |.:..|..|.:..|.:.....::..|:|||..|   |..:.....
  Fly   145 YAWLLTLRGLVGFAIGCV--PQSVTLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYY 207

  Fly   288 HWRWLLRVLYAP-AVLQILFLWILPESVRWLLSQGAEEKASNVLRRAARINQR------------ 339
            .||.||.:...| .:..||..| |.||.|:....|..:||..||.:.|..|:|            
  Fly   208 GWRGLLALSATPLLIFTILSPW-LSESARYYSYNGHNDKAIKVLEQIAHNNKRHMLMGRLMADDE 271

  Fly   340 PLPEEQLNDLLTSNRQKLSQANESQYPIMRAVVFFSLRIANCCLCWFTHTLIALGLSL-NSVNLG 403
            |...|....||:.:..:.:            ::.:.|.:|: ..|::...|:...|.: .:....
  Fly   272 PSCAESFRSLLSPSLYRTT------------ILLWFLWLAS-AFCYYGLVLVTTELLVARNKESH 323

  Fly   404 GNKYTNFMLNGFI--------QIPGLLLPLVIMDRVGRRHSLCASMLLCAICMGASAAVPADNYA 460
            .|:...||.:.|:        :.||:||.:.::...|::.::....|...:|.....:|.: .::
  Fly   324 PNECVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVES-RFS 387

  Fly   461 GSLALFLIGKLAITCSFQILYFFTSEIFPTNVRNTLLSLCSMVGRIGSMLAPQTPLLAKYYIYAP 525
            .|:.|| |.:..|:..||.:|.:|.||:|..:|:..:|.||::.|:|:||   ||.:|:..:.:.
  Fly   388 TSVTLF-IARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAML---TPFVAQVLMDSS 448

  Fly   526 QI-LFATFALISGFLTLA 542
            :| ..:|:|::....::|
  Fly   449 RIQAMSTYAIVGLLASIA 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 98/408 (24%)
MFS 161..544 CDD:119392 98/408 (24%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 98/408 (24%)
MFS 60..471 CDD:119392 98/408 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.