DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and T05A1.5

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:233 Identity:51/233 - (21%)
Similarity:101/233 - (43%) Gaps:28/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TISTEFGIYCEDEWKLSMVGTINNVGQ------FVGIPLGGYF----ADRYGRRTMLAVAGSVSA 215
            |:..||.|          ..|:.:.|:      |:|..:.|..    |||.|||.:|..:..:|.
 Worm   122 TVQNEFNI----------TKTLIDPGEMTSSIFFLGNGILGQIYAVAADRIGRRPVLIASLFISG 176

  Fly   216 LMGVIRSLSSNYSMFLVFEFLDMAVGSTLFPTAFLLAIELVGPKRRVAAATIITIFYALGEAFLG 280
            |.|:..:.:..:.:.|:..|...:..:.|....:::..|.:.......|:.:..:.:.:|...:.
 Worm   177 LSGIGAAYAPTFEIMLIGRFFQGSCFTALTMINWVMCCESISFSGHGYASVLFGLCWVIGYCSVS 241

  Fly   281 FLASQVQHWRWLLRVLYAPAVL-QILFLWILPESVRWLLSQGAEEKASNVLRRAARINQRPL--P 342
            .||.....||::......|.|| .||.::.||||..:|:::...:.....:..|:|:....:  .
 Worm   242 PLAMYFSTWRYVQLATSVPCVLFGILMMFTLPESFSFLVAKRKRDDLVKWIEMASRVGNEEIDYD 306

  Fly   343 EEQLNDLLTSNRQKLSQANESQYPIMRAVVFFSLRIAN 380
            .:|:.|:  |:|:   :.|||....::.|:...|.:.|
 Worm   307 ADQIVDM--SSRE---EDNESLLQTLKLVLQSKLMVTN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 51/233 (22%)
MFS 161..544 CDD:119392 51/233 (22%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 34/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163061
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D386678at33208
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.