DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and SLC22A31

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001371692.1 Gene:SLC22A31 / 146429 HGNCID:27091 Length:446 Species:Homo sapiens


Alignment Length:450 Identity:119/450 - (26%)
Similarity:182/450 - (40%) Gaps:76/450 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 ISTEFGIYCEDEWKLSMVGTINNVGQFVGIPLGGYFADRYGRRTMLAVAGSVSALMGVIRSLSSN 226
            :|..:.:.|.|.||:.:....:.:|..:|..:.|...||:|||.:...:..::..:|...:|:::
Human     5 LSQNWNLVCGDGWKVPLEQVSHLLGWLLGCVILGAGCDRFGRRAVFVASLVLTTGLGASEALAAS 69

  Fly   227 YSMFLVFEFLDMAVGSTL---FPTAFLLAIELVGPKRRVAAATIITIFYALGEAFLGFLASQVQH 288
            :...||...|.   |.||   ....:|..:||..|..|:|.:....:|..:|...|..||:.||.
Human    70 FPTLLVLRLLH---GGTLAGALLALYLARLELCDPPHRLAFSMGAGLFSVVGTLLLPGLAALVQD 131

  Fly   289 WRWLLRVLYAPAVLQILFLW----ILPESVRWLLSQGAEEKASNVLRRAARIN-----QRPLPEE 344
            || ||:.|.|.....:|..|    :.|||..|||:.|...:|..:|.|.|..:     ...|.|.
Human   132 WR-LLQGLGALMSGLLLLFWGFPALFPESPCWLLATGQVARARKILWRFAEASGVGPGDSSLEEN 195

  Fly   345 QLNDLLTSNRQKLSQAN-ESQYPIMRAVVFFSLRIANCCLCWFTHTLIALGLSLNSVNL-GGNKY 407
            .|...||....:..|.. .|...::|..|           .|..      ||.|...:| ||...
Human   196 SLATELTMLSARSPQPRYHSPLGLLRTRV-----------TWRN------GLILGFSSLVGGGIR 243

  Fly   408 TNFMLNGFIQIPGLLLP---------------LVIMDRVGRRHSL--------CASMLLCAICMG 449
            .:|..:...|:|...||               |:..|..|||..|        .||:||.|    
Human   244 ASFRRSLAPQVPTFYLPYFLEAGLEAAALVFLLLTADCCGRRPVLLLGTMVTGLASLLLLA---- 304

  Fly   450 ASAAVPADNYAGSLALFL--IGKLAITCSFQILYFFTSEIFPTNVRNTLLSLCSMVGRIGSMLAP 512
                 .|....|...|||  :|.||......:...|.:|:|||.:|...|.|....|.:|....|
Human   305 -----GAQYLPGWTVLFLSVLGLLASRAVSALSSLFAAEVFPTVIRGAGLGLVLGAGFLGQAAGP 364

  Fly   513 QTPLLAKYYIYAPQILFATFALISGFLTLAFPETADKVLPTTIEEARDLNQAKRRSERSP 572
            ...|..:...:..|::||:.|:::....|..||:..:.||.::::|       .|..|||
Human   365 LDTLHGRQGFFLQQVVFASLAVLALLCVLLLPESRSRGLPQSLQDA-------DRLRRSP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 114/430 (27%)
MFS 161..544 CDD:119392 110/420 (26%)
SLC22A31NP_001371692.1 MFS 9..383 CDD:421695 106/403 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.