DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7458 and SLC2A13

DIOPT Version :9

Sequence 1:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_443117.3 Gene:SLC2A13 / 114134 HGNCID:15956 Length:648 Species:Homo sapiens


Alignment Length:505 Identity:112/505 - (22%)
Similarity:178/505 - (35%) Gaps:157/505 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VGQFVGIPLGGYFADRYGRRTMLAVAGSVSALMGVIRSLSSNYSMFLVFEF---LDMAVGSTLFP 246
            |....|..|.|.|    |||..:.:|.::......:.:.::|....|....   |.:.:.|...|
Human   133 VSALAGGALNGVF----GRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVP 193

  Fly   247 TAFLLAIELVGPKRRVAAATIITIFYALGEAFL-----GFLASQVQHWRWLLRVLYAPAVLQILF 306
               :...|:..|..|....||.|:|...|:.|.     .|...|...||::|.:...|||:|...
Human   194 ---VYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVPAVIQFFG 255

  Fly   307 LWILPESVRWLLSQGAEEKASNVLRRAARINQRPLPEE--QLNDLLTSNRQKLSQANE------S 363
            ...||||.|||:.:|..:||..:|.: .|.|| .:.||  .:.:.:....:::..|..      |
Human   256 FLFLPESPRWLIQKGQTQKARRILSQ-MRGNQ-TIDEEYDSIKNNIEEEEKEVGSAGPVICRMLS 318

  Fly   364 QYPIMRAVV-------FFSLRIANCCLCWFTHTLI--------ALGLSLNSVNLGGNKYTNFMLN 413
            ..|..||::       |..|...| .:.:::.|::        .|.:.|.||    ..:|||:..
Human   319 YPPTRRALIVGCGLQMFQQLSGIN-TIMYYSATILQMSGVEDDRLAIWLASV----TAFTNFIFT 378

  Fly   414 GFIQIPGLLLPLVIMDRVGR--------------------------------------------- 433
                    |:.:.::::|||                                             
Human   379 --------LVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNAT 435

  Fly   434 --RHSLCASMLL---CAICMGA-------SAAVPADNYAGSLALFLIGKLAITCSFQ-------- 478
              |:|.|...:|   |..|...       |:.||.:..:.:.|.:  |:......|:        
Human   436 CTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAW--GRCENETKFKTEDIFWAY 498

  Fly   479 ---------------ILY--FF-----------TSEIFPTNVRNTLLSLCSMVGRIGSMLAPQTP 515
                           |||  ||           .|||:|...|:|..:..|.:..|.::|...|.
Human   499 NFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTF 563

  Fly   516 LLAKYYI--YAPQILFATFALISGFLTL--AFPETADKVLPTTIEEARDL 561
            |....|:  |....|:|.||.: |.|.:  ..|||..|.|    ||...|
Human   564 LHTAEYLTYYGAFFLYAGFAAV-GLLFIYGCLPETKGKKL----EEIESL 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7458NP_649374.1 2A0119 46..554 CDD:273328 109/496 (22%)
MFS 161..544 CDD:119392 104/486 (21%)
SLC2A13NP_443117.3 Sugar_tr 84..609 CDD:278511 112/505 (22%)
MFS 86..591 CDD:119392 104/482 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.