DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNApol-eta and ECO1

DIOPT Version :9

Sequence 1:NP_649371.2 Gene:DNApol-eta / 40438 FlyBaseID:FBgn0037141 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_116683.1 Gene:ECO1 / 850584 SGDID:S000001923 Length:281 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:33/165 - (20%)
Similarity:66/165 - (40%) Gaps:22/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 QAAKKRRVSGDEPGQL-PKVEMEKKQKQTDEFKMKSFFANYLQGAKKEDAKADGISANPLAAAAG 528
            :|.|.:|.:|.:|..: .|:::....|.....|......:|...:.::.|..:......|.....
Yeast     2 KARKSQRKAGSKPNLIQSKLQVNNGSKSNKIVKCDKCEMSYSSTSIEDRAIHEKYHTLQLHGRKW 66

  Fly   529 APNKNFVEEYKHKLHAAV----RTEGTV--LTSTPAEFKESFFSQ------YLKQQKKTGQQGSV 581
            :||...: .|..:.|:..    |:.||:  |.|:|.:......:.      |::..|..|:..::
Yeast    67 SPNWGSI-VYTERNHSRTVHLSRSTGTITPLNSSPLKKSSPSITHQEEKIVYVRPDKSNGEVRAM 130

  Fly   582 TSREDSLDVQELA-EELDAIEADNSKDFEEDTEEE 615
            |      ::..|. .||:| ..|.:..:...|||:
Yeast   131 T------EIMTLVNNELNA-PHDENVIWNSTTEEK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNApol-etaNP_649371.2 PolY_Pol_eta 20..447 CDD:176456
zf_UBZ 705..736 CDD:408236
zf_UBZ 805..832 CDD:408236
ECO1NP_116683.1 zf-C2H2_3 18..57 CDD:404719 5/38 (13%)
Acetyltransf_13 209..267 CDD:404721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4551
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.