DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A and AT4G08895

DIOPT Version :9

Sequence 1:NP_649370.1 Gene:SLC22A / 40437 FlyBaseID:FBgn0037140 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_680669.1 Gene:AT4G08895 / 826467 AraportID:AT4G08895 Length:155 Species:Arabidopsis thaliana


Alignment Length:200 Identity:47/200 - (23%)
Similarity:67/200 - (33%) Gaps:68/200 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FTKNKEACA-HNEFVFRDDEVTISNDFGIFCDDEWKLSMVGTINNLGQFFGIPIGGFVADRYGRS 190
            |.|.:.||: .|.||..|...|    ||      | |....|:|.|.:.|.|.....:       
plant     6 FPKTRLACSPRNSFVVTDSFTT----FG------W-LPSAKTMNALQELFMIVRAQTI------- 52

  Fly   191 FSIALGGILGAVLGVIRSFSPSYGW--------FLVFE----FLDNMTSSTLYSTCFVIGIELVG 243
              ||....:.||        |.:.|        |::|.    |..|...:   :|.|::..|:. 
plant    53 --IACCSTVPAV--------PYHHWTLPANRIGFVIFYSFTFFFSNFGPN---ATTFIVPAEIF- 103

  Fly   244 PKRRVLACSVITVFYAVGEVLLAMSAKAFHDWRILLRITYGPSLILLAYFWILPESVRWLLSQGK 308
            |.|....|..|:          |.|.||             .:::....|..|..|:..|..:.|
plant   104 PARIRSTCHGIS----------AASGKA-------------GAMVGSFGFAALGISLEELTGETK 145

  Fly   309 EERAK 313
            .||.|
plant   146 PERVK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22ANP_649370.1 2A0119 35..540 CDD:273328 46/199 (23%)
MFS 146..530 CDD:119392 38/179 (21%)
AT4G08895NP_680669.1 2A0109 <23..133 CDD:129965 33/164 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D762280at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.