DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A and T05A1.5

DIOPT Version :9

Sequence 1:NP_649370.1 Gene:SLC22A / 40437 FlyBaseID:FBgn0037140 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:263 Identity:55/263 - (20%)
Similarity:95/263 - (36%) Gaps:80/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VTISNDFGI---FCDDEWKLSMVGTINN--LGQFFGIPIGGFVADRYGRSFSIALGGILGAVLGV 205
            ||:.|:|.|   ..|.....|.:..:.|  |||.:.:     .|||.||...:.....:..:.|:
 Worm   121 VTVQNEFNITKTLIDPGEMTSSIFFLGNGILGQIYAV-----AADRIGRRPVLIASLFISGLSGI 180

  Fly   206 IRSFSPSY--------------------GWFLVFE---FLDNMTSSTLYSTCFVIGIELVGPKRR 247
            ..:::|::                    .|.:..|   |..:..:|.|:..|:|||.        
 Worm   181 GAAYAPTFEIMLIGRFFQGSCFTALTMINWVMCCESISFSGHGYASVLFGLCWVIGY-------- 237

  Fly   248 VLACSVITVFYAVGEVLLAMSAKAFHDWRILLRITYGPSLIL-LAYFWILPESVRWLLSQGKEER 311
               |||..:            |..|..||.:...|..|.::. :...:.||||..:|:::.|.:.
 Worm   238 ---CSVSPL------------AMYFSTWRYVQLATSVPCVLFGILMMFTLPESFSFLVAKRKRDD 287

  Fly   312 AKNILRRAAHVNKRELP----------------ESVLDKLVLANRDKLQQSSESRFPIREAFKNF 360
            ....:..|:.|...|:.                ||:|..|.|..:.||..::       .|.:.|
 Worm   288 LVKWIEMASRVGNEEIDYDADQIVDMSSREEDNESLLQTLKLVLQSKLMVTN-------TAVETF 345

  Fly   361 KWR 363
            .|:
 Worm   346 LWK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22ANP_649370.1 2A0119 35..540 CDD:273328 55/263 (21%)
MFS 146..530 CDD:119392 55/263 (21%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 36/177 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D386678at33208
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.