DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mub and AT1G51580

DIOPT Version :9

Sequence 1:NP_001246875.1 Gene:mub / 40436 FlyBaseID:FBgn0262737 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_175569.1 Gene:AT1G51580 / 841583 AraportID:AT1G51580 Length:621 Species:Arabidopsis thaliana


Alignment Length:390 Identity:87/390 - (22%)
Similarity:152/390 - (38%) Gaps:96/390 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LTIRLIMQGKEVGSIIGKKGEIVNRFREESGAKINISDGS--CPERIVTVSGTTNAIFSAFTLIT 86
            :..||:....:|||:|||.|.:|...:.||||.|.:||.:  ..|||:.:|...| :....:|..
plant   276 VAFRLLCPADKVGSLIGKGGAVVRALQNESGASIKVSDPTHDSEERIIVISAREN-LERRHSLAQ 339

  Fly    87 KKFEEWCSQFNDVGKVGKTQIPIRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQVASE----ML 147
            .......::..::|......:..||:|.:...|.|:||.|..|.|:|:.||.||:|.::    ..
plant   340 DGVMRVHNRIVEIGFEPSAAVVARLLVHSPYIGRLLGKGGHLISEMRRATGASIRVFAKDQATKY 404

  Fly   148 PNSTERAVTLSGSAEQITQCIYQICLVMLES-------------PPRGATIPYRPKPQVTGPVIL 199
            .:..:..|.:.|:.:.:...::||...:.|:             ||.....||...|...||   
plant   405 ESQHDEIVQVIGNLKTVQDALFQILCRLREAMFPGRLPFQGMGGPPPPFMGPYPEPPPPFGP--- 466

  Fly   200 ANGQAFTIQGNY-AVPTQETCPVFPLALATGGLH---------------------AGISGLADPL 242
                     ..| |.|.:...||       |..|                     :.:|....|.
plant   467 ---------RQYPASPDRYHSPV-------GPFHERHCHGPGFDRPPGPGFDRPPSPMSWTPQPG 515

  Fly   243 LKGAHLQGAIPAHHHH---LQQMPDVAKNPLASLAALGLAGMNPASTGGINHTANPANRAQQQQH 304
            :.| |..|.:|...:|   |:..|..::||:.:.|.:                            
plant   516 IDG-HPGGMVPPDVNHGFALRNEPIGSENPVMTSANV---------------------------- 551

  Fly   305 EMTVSNDLIGCIIGKGGTKIAEIRQISGAMIRISNCEEREGGNTDRTITISGNPDSVALAQYLIN 369
            |:.:....:|.:.|:..:.:..|:|:|||.:.:   .:.:.|.|:..:.:||..|....||.|::
plant   552 EIVIPQAYLGHVYGENCSNLNYIKQVSGANVVV---HDPKAGTTEGLVVVSGTSDQAHFAQSLLH 613

  Fly   370  369
            plant   614  613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mubNP_001246875.1 PCBP_like_KH 25..86 CDD:239089 23/62 (37%)
PCBP_like_KH 109..172 CDD:239089 19/66 (29%)
KH-I 305..368 CDD:238053 15/62 (24%)
AT1G51580NP_175569.1 KH-I 21..83 CDD:412160
KH-I_PEPPER_rpt2_like 149..221 CDD:411888
KH-I_PEPPER_rpt1_like 275..343 CDD:411887 23/67 (34%)
KH-I 361..433 CDD:412160 20/71 (28%)
KH-I 551..616 CDD:412160 16/94 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1137
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10288
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.