DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mub and AT2G03110

DIOPT Version :9

Sequence 1:NP_001246875.1 Gene:mub / 40436 FlyBaseID:FBgn0262737 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001318188.1 Gene:AT2G03110 / 814840 AraportID:AT2G03110 Length:153 Species:Arabidopsis thaliana


Alignment Length:152 Identity:36/152 - (23%)
Similarity:73/152 - (48%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KINISDGSCPERIVTVSGTT------------------NAIFSAFTL-ITKKFEEWCSQFNDVGK 101
            ::|.:...|.||:||:...:                  :|:|....: :.::|:: ...:||..:
plant     2 RVNEALPGCDERVVTIYSNSEERNRIEDDNEDFVCPAFDALFKVHDMVVVEEFDD-DDDYNDNDE 65

  Fly   102 V--GKTQIPIRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQVASEMLPN-----STERAVTLSG 159
            .  |:|.:.:|::||:.|.|.||||.|..|:.:|..|...|:|.::.||.     |.:..:.:.|
plant    66 YSEGQTVVTVRMLVPSDQIGYLIGKGGPIIQTLRNDTNAQIRVRNDNLPMCALALSHDELLQIIG 130

  Fly   160 SAEQITQCIYQICLVMLESPPR 181
            ....:.:.:||:..::..:|.|
plant   131 DPSAVREALYQVAFLLYNNPSR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mubNP_001246875.1 PCBP_like_KH 25..86 CDD:239089 8/48 (17%)
PCBP_like_KH 109..172 CDD:239089 21/67 (31%)
KH-I 305..368 CDD:238053
AT2G03110NP_001318188.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.