DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mub and igf2bp3

DIOPT Version :9

Sequence 1:NP_001246875.1 Gene:mub / 40436 FlyBaseID:FBgn0262737 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_009292473.1 Gene:igf2bp3 / 30967 ZFINID:ZDB-GENE-000308-1 Length:607 Species:Danio rerio


Alignment Length:359 Identity:85/359 - (23%)
Similarity:144/359 - (40%) Gaps:79/359 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IRLIMQGKEVGSIIGKKGEIVNRFREESGAKINI---SDGSCPERIVTVSGTTNAIFSAFTLI-- 85
            :||::..:.||:||||:|..:....:::.:||:|   .:....|:.:||..|.....||...|  
Zfish   197 LRLLVPTQFVGAIIGKEGATIRNITKQTHSKIDIHRKENAGAAEKPITVHSTPEGCSSACRNIME 261

  Fly    86 --------TKKFEEWCSQFNDVGKVGKTQIPIRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQV 142
                    ||..||               ||::::...:..|.||||.|..:|:|.|.|...|.:
Zfish   262 IMQKEAIDTKITEE---------------IPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITI 311

  Fly   143 A--SEMLPNSTERAVTLSGSAEQITQCIYQICLVMLESPPRGATIPYRPKPQVTGPVILANGQAF 205
            :  .::...:.||.:|:.|:.:...:...:|...:.||........:.....:.|..:.|.|   
Zfish   312 SPLQDLTLYNPERTITVKGTLDACAKAEEEIMKKVRESYENDVAAMHLQSNLIPGLNLNALG--- 373

  Fly   206 TIQGNYAVPTQETCPVFPLALATGGLHAGISGLADPLLKGAHLQGAIPAHHHHLQQMPDVAKNPL 270
                           :||.| |:||:...:  ::.|                     |..|:...
Zfish   374 ---------------LFPGA-ASGGISPSV--VSGP---------------------PPGAQAGY 399

  Fly   271 ASLAALGLAGMNP--ASTGGINH--TANPANRAQQQQHEMTVSNDLIGCIIGKGGTKIAEIRQIS 331
            .|....|..|..|  |||...|.  ||..|....:..| :.:....:|.||||.|..|.::.:.:
Zfish   400 QSFGCSGFEGEVPFWASTLSSNSGCTAFSAQMESETVH-LFIPALAVGAIIGKQGQHIKQLSRFA 463

  Fly   332 GAMIRISNCEEREGGNTDRTITISGNPDSVALAQ 365
            ||.|:|:..:..:.  ..|.:.|||.|::...||
Zfish   464 GASIKIAPADGIDA--KQRMVIISGPPEAQFKAQ 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mubNP_001246875.1 PCBP_like_KH 25..86 CDD:239089 19/72 (26%)
PCBP_like_KH 109..172 CDD:239089 15/64 (23%)
KH-I 305..368 CDD:238053 18/61 (30%)
igf2bp3XP_009292473.1 RRM1_IGF2BP3 1..77 CDD:241071
RRM2_IGF2BP3 81..156 CDD:241074
KH-I 197..260 CDD:238053 18/62 (29%)
KH-I 278..343 CDD:238053 15/64 (23%)
KH-I 435..498 CDD:238053 19/64 (30%)
KH-I 517..582 CDD:238053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394765at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.