DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mub and igf2bp2a

DIOPT Version :9

Sequence 1:NP_001246875.1 Gene:mub / 40436 FlyBaseID:FBgn0262737 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001108030.2 Gene:igf2bp2a / 100136839 ZFINID:ZDB-GENE-070912-44 Length:607 Species:Danio rerio


Alignment Length:420 Identity:101/420 - (24%)
Similarity:175/420 - (41%) Gaps:85/420 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSSSAGGASIKHEDPSVTLTIRLIMQGKEVGSIIGKKGEIVNRFREESGAKINI---SDGSCPER 67
            ||.|:.|:..|..|    ..:|:::..:.||:||||:|..:....:::.:|::|   .:....|:
Zfish   184 TSGSSLGSRQKQPD----FPLRMLVPTQFVGAIIGKEGLTIKNITKQTQSKVDIHRKENAGAAEK 244

  Fly    68 IVTVSGTTNAIFSAFTLI----------TKKFEEWCSQFNDVGKVGKTQIPIRLIVPASQCGSLI 122
            .:|:..|.....:|..:|          ||..|:               ||::::...|..|.||
Zfish   245 PITIHSTPEGCSTACHMIMDIMQKEAVDTKVTED---------------IPLKILAHNSLVGRLI 294

  Fly   123 GKSGSKIKEIRQTTGCSIQVAS--EMLPNSTERAVTLSGSAEQITQCIYQICLVMLESPPRGATI 185
            ||.|..:|:|.:.|...|.::|  ::...:.||.:.:.||.|...:...:|...:.|:       
Zfish   295 GKEGRNLKKIEEDTETKITISSLQDLTIYNPERTIIVKGSIEACCRAEVEIMKKLREA------- 352

  Fly   186 PYRPKPQVTGPVILANGQAFTIQGNYAVPTQETCPVFPLALATGGLHA-GISGLADPLLKGAHLQ 249
                   ....|...|.|:..|.|              |:|:..|:.: |:|.|  |...|..  
Zfish   353 -------YENDVAAINQQSNLIPG--------------LSLSALGIFSTGLSVL--PPAAGPR-- 392

  Fly   250 GAIPAHHHHLQQMPDVAKNPLASLAAL--GLAGMNPASTGGINHTANPANRAQQQQHEMTVSNDL 312
             .||       .:|....||....::.  ||.|:.|||  ||:|....|  .:|:...:.:....
Zfish   393 -GIP-------PVPPTGYNPFLGHSSQLGGLYGVPPAS--GISHQHTQA--PEQEVVYLFIPTQA 445

  Fly   313 IGCIIGKGGTKIAEIRQISGAMIRISNCEEREGGNTDRTITISGNPDSVALAQYLINMSVELQKA 377
            :|.||||.|..|.::.:.:||.|:|:..|..:  .|.|.:.|:|.|::...||..|  ..:|::.
Zfish   446 VGAIIGKKGQHIKQLARFAGASIKIAPAESPD--VTQRMVIITGPPEAQFKAQGRI--FGKLKEE 506

  Fly   378 NLLEQAQSQQNGGAAAAPGAAAAGVAAVTG 407
            |.....:..:.......|.:||..|....|
Zfish   507 NFFTAKEEVKLETHIKVPSSAAGRVIGKGG 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mubNP_001246875.1 PCBP_like_KH 25..86 CDD:239089 15/73 (21%)
PCBP_like_KH 109..172 CDD:239089 17/64 (27%)
KH-I 305..368 CDD:238053 19/62 (31%)
igf2bp2aNP_001108030.2 RRM1_IGF2BP2 1..77 CDD:241070
RRM <2..>77 CDD:223796
RRM_SF 81..156 CDD:302621
KH-I 200..263 CDD:238053 14/62 (23%)
KH-I 281..346 CDD:238053 17/64 (27%)
COG4020 <314..385 CDD:304975 18/98 (18%)
PCBP_like_KH 439..500 CDD:239089 20/64 (31%)
KH-I 518..582 CDD:238053 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.