DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh1 and CG31076

DIOPT Version :9

Sequence 1:NP_001189159.1 Gene:P5CDh1 / 40434 FlyBaseID:FBgn0037138 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster


Alignment Length:107 Identity:25/107 - (23%)
Similarity:45/107 - (42%) Gaps:19/107 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LIDFIRMNAYFLKEVTKYQPISENIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLSYTPALMGN 239
            ::|..||:...|:.:|...|..|.:.:.||  .:..:...:..:..| |.    ||.|. :|.||
  Fly    59 VLDSNRMHEAHLRTLTCPLPQLEVLMLNKN--EFSDLPTTMRLIRKF-FP----NLQYL-SLHGN 115

  Fly   240 -----GVLWKPSDTAM------LSNWIIFKIMREAGVPDGVV 270
                 |:..:|..|.:      .||:|...:.:...:..|:|
  Fly   116 PICPDGLELQPFSTYLRYDYEYYSNYIAQSLSKLKFLDHGLV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh1NP_001189159.1 ALDH_F4-17_P5CDH 41..563 CDD:143441 25/107 (23%)
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 1/5 (20%)
leucine-rich repeat 11..32 CDD:275378
leucine-rich repeat 33..54 CDD:275378
leucine-rich repeat 55..79 CDD:275378 5/19 (26%)
leucine-rich repeat 80..106 CDD:275378 5/32 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.