DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh1 and ALDH1L2

DIOPT Version :9

Sequence 1:NP_001189159.1 Gene:P5CDh1 / 40434 FlyBaseID:FBgn0037138 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001029345.2 Gene:ALDH1L2 / 160428 HGNCID:26777 Length:923 Species:Homo sapiens


Alignment Length:581 Identity:136/581 - (23%)
Similarity:239/581 - (41%) Gaps:94/581 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RMMRSSSSRCS--SLQQSLLKSSTRCLG---SVIPDLKLKDFPIANEPILGYLKDSKE------R 56
            |::.....:|.  .||...:..:|:..|   .|:..|:.:|..:  |.::.|:  |||      :
Human   380 RLVEEIRQKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEV--ELVVDYI--SKEVNEIMVK 440

  Fly    57 KALEQALKGTASSCEDIPIVIGGKEYKTPEVRYQVMPHDHQHKLASFYYADKKLIEKAIKTAVET 121
            ...:..:.|..:..:|      ||.|.|      :.|.|.. .:....||....::||:..|.:.
Human   441 MPYQCFINGQFTDADD------GKTYDT------INPTDGS-TICKVSYASLADVDKAVAAAKDA 492

  Fly   122 --QPKWDRVSIADRLKIWEKAADL-------MATTYRQDLNAATMLGQSKTAIQAEIDSAAELID 177
              ..:|.|::..:|.::..:.|||       :||....|..|...|     |::..|..:.:.. 
Human   493 FENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTL-----ALKTHIGMSVQTF- 551

  Fly   178 FIRMNAYFLKEVTKYQ----PISE-----NIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLSYT 233
                 .||.....|.|    ||::     |:..||....     |..|.:.|:|:          
Human   552 -----RYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPL-----GVCAIIIPWNY---------- 596

  Fly   234 PALM-----------GNGVLWKPSDTAMLSNWIIFKIMREAGVPDGVVNFVPADGPVFGDTITAS 287
            |.:|           ||.::.||:....|:.....::..:||.|.||:|.:|..|.:.|..::..
Human   597 PLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSEH 661

  Fly   288 PHLAGINFTGSVPTFNRLWKQVGNNIDNYVNFPRLTGECGGKNFHFIHASADVESVVTSTIRSAF 352
            |.:..:.||||.|...::.|....:     |..:::.|.|||:...|....:::..|...:.:.|
Human   662 PDIRKLGFTGSTPIGKQIMKSCAVS-----NLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAVF 721

  Fly   353 EYCGQKCSACSRMYVPESLWPQIKEGLVCEAAKLKIGDVQDFSSFTSAVIDDKAFKRITGYIEHA 417
            ...|:.|.|..|::|.||:..:....:|.|..|:||||..|.|:...........:::..|.|..
Human   722 FNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCETG 786

  Fly   418 KKSPNLEILAGGTYSDSKGYFVNPTIVLSKDPKDRIMTEEIFGPVLSIYVYKESDLLETMKLVHT 482
            .|. ...::.||......|:|:.||:....:....:..||.|||::.|..::..|:...::..: 
Human   787 VKE-GATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGDIDGVLQRAN- 849

  Fly   483 STKFALTGAVFGQDEDFVKCALQEFKMAAGNFYINDKSTGSVVGQQPFGGGRMSGTNDKAG 543
            ||::.|...||.:|.:  |......|:.||..:||..:...|..  ||||.:.||.....|
Human   850 STEYGLASGVFTRDIN--KAMYVSEKLEAGTVFINTYNKTDVAA--PFGGVKQSGFGKDLG 906

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh1NP_001189159.1 ALDH_F4-17_P5CDH 41..563 CDD:143441 127/538 (24%)
ALDH1L2NP_001029345.2 Fmt 22..326 CDD:223301
FMT_core_FDH_N 23..225 CDD:187716
GART 23..225
FDH_Hydrolase_C 228..327 CDD:187731
PP-binding 346..>390 CDD:278949 1/9 (11%)
Aldehyde dehydrogenase 438..923 122/519 (24%)
ALDH_F1L_FTFDH 439..923 CDD:143458 122/518 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.