DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and SKIP1

DIOPT Version :10

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_568870.1 Gene:SKIP1 / 835901 AraportID:AT5G57900 Length:300 Species:Arabidopsis thaliana


Alignment Length:120 Identity:31/120 - (25%)
Similarity:49/120 - (40%) Gaps:30/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 LEPGWDEKLPIWTHR---------RLKRLAICSWT----------HSADYLKRYTC--MTELQLL 336
            ||| |.:..|..||.         .|...::..|:          |.:|:...|..  ...||:|
plant    54 LEP-WFDSYPESTHLWSPEFEQKVDLMLRSVVDWSEGGLTKIRVRHCSDHALSYAADRCPNLQVL 117

  Fly   337 CVRNWNDLSDEILLEFVELCPRLEHLDVSYCRNLTPTFL-------PRALSILKR 384
            .:|:..:::|..:.:....|..|:.||:|||..::...|       |. |.||||
plant   118 AIRSSPNVTDASMTKIAFRCRSLKELDISYCHEISHDTLVMIGRNCPN-LRILKR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 F-box_SF 9..47 CDD:459239
leucine-rich repeat 333..358 CDD:275381 6/24 (25%)
SKIP1NP_568870.1 F-box_SF 7..53 CDD:459239
AMN1 <89..>253 CDD:187754 22/84 (26%)
leucine-rich repeat 91..113 CDD:275381 3/21 (14%)
leucine-rich repeat 114..139 CDD:275381 6/24 (25%)
leucine-rich repeat 140..165 CDD:275381 7/24 (29%)
leucine-rich repeat 187..209 CDD:275381
leucine-rich repeat 210..234 CDD:275381
leucine-rich repeat 235..260 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.